CAZyme Information: MGYG000000494_01256

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-269
• CAZyme ID: MGYG000000494_01256
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
874		95697.02	7.1484

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000494	1504589	MAG	Fiji	Oceania

• Gene Location: Start: 6699; End: 9323 Strand: -

Full Sequence      

MGKKRKKSTNNGTYKNRKTRNKTVEKRGNKDAKAKRKDTKMKLKYKHPKLALFLKIILII
FVILIVIGAGVAVGLIYGLYGEDFSIDMSELIMKENSMIMDTDKEVLAELNGDESRKIIT
LEEMSPYLPKAYISIEDERFEQHHGVDIKRTGAAVLSFVTHGGKSTAGGGSTITQQVVKN
VTQEKASSGAAGVVRKLKEWSKAYQIEKVMSKDQIIELYLNLIYVGNGGSEKHGVEIGAE
YYFNKTAKDLSIAQCAFLAGINHSPNAYNPYSGNDVTEKISKRTKTVLSQMKKFNYINQE
EYDNAVAEVEAGFKFENGVRGNVYSSHTDALITQLTQQIMEEKQISKDAAETYLQTSGLK
IYSTQVSSIQKAMEAEVQKGKYKLELKDKNGKVIKDENGASILAEGAAVVIEPSTGKVVG
AVGQLREKTTSRGLNRINSKRQTGSSIKPLADVLPGIEEGIITPATIYADLKTTFGKDYE
PENYNGFTGLRTIRTAVTTSQNIPFLKVMAELTPQKSIEYMEKMGISSLVHASENKDHND
ENLSLAIGGMTYGVSPLEMAAAYAAVANDGNYIGPTFYTKVEDSDGKVVLEPKQKTETVC
SAETAYIIKNLMQSVINGADGYAGTAKYCAINGIDVAAKTGTTNSSKDRWLCGFTNYYAC
AAWYGFDDPQRINFSGTNPAGLLFSGIMSEIHKGLENSTFKVPDKIVHATICRTSGRIAT
NKCSSTYDEIFVDGHLPEECDAHQNQYTICRESGRLANEFCPSKERKSANYVVEKERLGL
WTTHGIGTTMGTAPTEYCTIHKKAAEVVTQPTVPETPTEQPNVNTEPEKPNNSGTEEPTK
PDTGPTEEPEKPSSGDTGNTETGGSTTDNTTNNQ

Enzyme Prediction     

No EC number prediction in MGYG000000494_01256.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	104	292	2.1e-54	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0744	MrcB	6.03e-144	68	701	28	606	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	5.15e-138	116	694	2	531	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG5009	MrcA	2.57e-105	99	746	51	774	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
TIGR02071	PBP_1b	2.19e-69	100	692	120	683	penicillin-binding protein 1B. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in E. coli and other Proteobacteria, designated penicillin-binding protein 1B. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG4953	PbpC	6.69e-67	111	770	53	635	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEV70266.1	5.53e-118	92	743	69	705
QNU66566.1	1.73e-115	92	743	71	719
AHM56289.1	5.63e-113	72	738	36	747
ALU14173.1	3.32e-109	74	741	75	767
CBH21448.1	3.47e-109	71	748	42	765

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7U4H_A	3.08e-73	88	737	13	807	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
3ZG8_B	7.24e-52	205	682	2	449	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
4OON_A	3.62e-49	112	737	35	768	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
3DWK_A	1.43e-48	99	706	10	602	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
3ZG7_B	6.23e-47	205	682	2	449	CrystalStructure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the apo form [Listeria monocytogenes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7GHV1	2.47e-87	91	741	51	699	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) OX=441772 GN=pbpA PE=3 SV=1
A5I6G4	5.01e-87	91	741	51	699	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) OX=441771 GN=pbpA PE=3 SV=1
A7FY32	5.01e-87	91	741	51	699	Penicillin-binding protein 1A OS=Clostridium botulinum (strain ATCC 19397 / Type A) OX=441770 GN=pbpA PE=3 SV=1
Q891X1	5.95e-86	95	743	59	713	Penicillin-binding protein 1A OS=Clostridium tetani (strain Massachusetts / E88) OX=212717 GN=pbpA PE=3 SV=1
Q0SRL7	1.85e-82	93	747	68	728	Penicillin-binding protein 1A OS=Clostridium perfringens (strain SM101 / Type A) OX=289380 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999933	0.000103	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
50	72