CAZyme Information: MGYG000000495_00400

Basic Information

• Species: HGM11501 sp900766735
• Lineage: Bacteria; Firmicutes_A; Clostridia; UMGS1883; HGM11501; HGM11501; HGM11501 sp900766735
• CAZyme ID: MGYG000000495_00400
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
553		62475.23	5.0542

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000495	2149207	MAG	Fiji	Oceania

• Gene Location: Start: 13376; End: 15037 Strand: +

Full Sequence      

MNSIFTEGTPDARSKRYIAPKRLVWQSGPVDSPEKIIESEKPVQATLNPMNNFCTMKEGG
SILVDFGCELHGGLALVIQGCSCEVEKAGSLHIRFGESVMECMTPVFTEKNPTNDHAIRD
FDLMVPTMGTIEVGYTGFRFVRIDCLKGYAQLSVIRATFTYQDVEYKGSFESDDEMLNKI
WETAVYTVHLNMQNFLWDGIKRDRLVWIGDMHPETSTIQKVFGYNECVPKSLDFTRECFE
PNKWINNIPSYSMWWIKIHWDWYMQNGDYEYLYEQKDYLYKMLEFIFTKIKDDGTIDIDR
TFIDWPTEPDPKGSRAGMHAILTMAIDAAANIAGEYKDEAMRERCLGYAKILKTHVPEPG
DCKQAAALLALAGCLDYDKVNKEVLSVDPLHKLSTFLGYYILKARGEAGDVTGTIELMDK
FWGKMIELGATTFFEDFNLEWADNAYRIDELVPEGANDIHGDHGAFCYKGFRHSLCHGWA
SGPAAYIQEYILGVKVLEPGCKKVRVAPNLGSLNHIKGTYPTPYGNISIEATRNSNGETE
VKVSAPGAVTVVR

Enzyme Prediction     

No EC number prediction in MGYG000000495_00400.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	58	550	1e-88	0.9801587301587301

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	7.93e-09	168	340	4	196	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	3.94e-04	493	537	1	46	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMV41231.1	2.67e-193	11	552	8	556
AUD07449.1	2.89e-191	11	553	38	583
AFC30266.1	3.61e-190	9	553	11	564
AEI41762.1	3.61e-190	9	553	11	564
QGQ98689.1	5.90e-190	9	552	8	557

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	1.32e-38	38	529	179	674	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	9.41e-13	56	490	89	541	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000495_00400.