CAZyme Information: MGYG000000496_00911

Basic Information

• Species: CAG-1000 sp900768345
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; CAG-1000; CAG-1000 sp900768345
• CAZyme ID: MGYG000000496_00911
• CAZy Family: CBM50
• CAZyme Description: Cell division suppressor protein YneA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
403	MGYG000000496_3|CGC2	45353.53	9.7031

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000496	1275836	MAG	Fiji	Oceania

• Gene Location: Start: 271260; End: 272471 Strand: -

Full Sequence      

MALKGIVIDPGHGGTDPGAVSNGLKEKDFTLRISKYMYDRLKELGVPVRLTRDSDVTLTP
KERINKVQSFFGDSKDVVVVSNHLNAGGGDGAEVIYALRNNSTLSKKILNELEKEGQNVR
KYYQQRLPSNPIKDYYFMQRNTPNNETITVEYGFIDSPKDDVEQIEKNYKNYVEAVIRAL
ADYKGFKYTPPLGSDYYTVKKGDSLWSIANKYGVTVKELKEINKLTSNTLKVGQTLKLTK
NDEMTPEDYLIYKVKSGDSLWDIAKEYNTTVATLKKINNLTSDKLTVNQQLFIPKSDNSS
VKKTGEINYVVQKGDNLWTIANKYDTTINDIKNLNNLKTNTLQIGQVLKIPGSTNYNTYT
VKKGDSLWKIADKYGTSVNKLMTINNLTSTTLQIGQSILIPTN

Enzyme Prediction     

No EC number prediction in MGYG000000496_00911.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	197	238	1.8e-17	0.95
CBM50	309	351	2.9e-16	0.975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK06347	PRK06347	2.03e-44	197	400	333	591	1,4-beta-N-acetylmuramoylhydrolase.
cd02696	MurNAc-LAA	5.29e-35	6	182	2	169	N-acetylmuramoyl-L-alanine amidase or MurNAc-LAA (also known as peptidoglycan aminohydrolase, NAMLA amidase, NAMLAA, Amidase 3, and peptidoglycan amidase; EC 3.5.1.28) is an autolysin that hydrolyzes the amide bond between N-acetylmuramoyl and L-amino acids in certain cell wall glycopeptides. These proteins are Zn-dependent peptidases with highly conserved residues involved in cation co-ordination. MurNAc-LAA in this family is one of several peptidoglycan hydrolases (PGHs) found in bacterial and bacteriophage or prophage genomes that are involved in the degradation of the peptidoglycan. In Escherichia coli, there are five MurNAc-LAAs present: AmiA, AmiB, AmiC and AmiD that are periplasmic, and AmpD that is cytoplasmic. Three of these (AmiA, AmiB and AmiC) belong to this family, the other two (AmiD and AmpD) do not. E. coli AmiA, AmiB and AmiC play an important role in cleaving the septum to release daughter cells after cell division. In general, bacterial MurNAc-LAAs are members of the bacterial autolytic system and carry a signal peptide in their N-termini that allows their transport across the cytoplasmic membrane. However, the bacteriophage MurNAc-LAAs are endolysins since these phage-encoded enzymes break down bacterial peptidoglycan at the terminal stage of the phage reproduction cycle. As opposed to autolysins, almost all endolysins have no signal peptides and their translocation through the cytoplasmic membrane is thought to proceed with the help of phage-encoded holin proteins. The amidase catalytic module is fused to another functional module (cell wall binding module or CWBM) either at the N- or C-terminus, which is responsible for high affinity binding of the protein to the cell wall.
pfam01520	Amidase_3	4.23e-32	6	180	1	172	N-acetylmuramoyl-L-alanine amidase. This enzyme domain cleaves the amide bond between N-acetylmuramoyl and L-amino acids in bacterial cell walls.
COG0860	AmiC	8.79e-29	6	183	45	227	N-acetylmuramoyl-L-alanine amidase [Cell wall/membrane/envelope biogenesis].
TIGR02883	spore_cwlD	1.66e-22	4	183	1	189	N-acetylmuramoyl-L-alanine amidase CwlD. Members of this protein family are the CwlD family of N-acetylmuramoyl-L-alanine amidase. This family has been called the germination-specific N-acetylmuramoyl-L-alanine amidase. CwlD is required, along with the putative deactylase PdaA, to make muramic delta-lactam, a novel peptidoglycan constituent found only in spores. CwlD mutants show a germination defect. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan, Cellular processes, Sporulation and germination]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVK20078.1	1.16e-66	6	294	2	284
QIC05530.1	5.52e-47	1	194	80	266
AGR47373.1	8.73e-46	1	194	153	339
AYB39952.1	5.17e-43	1	193	152	337
AUM64330.1	9.43e-43	1	188	152	332

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5J72_A	6.48e-13	2	160	450	612	ChainA, Putative N-acetylmuramoyl-L-alanine amidase,autolysin cwp6 [Clostridioides difficile 630],5J72_B Chain B, Putative N-acetylmuramoyl-L-alanine amidase,autolysin cwp6 [Clostridioides difficile 630]
4B8V_A	3.51e-11	197	351	44	217	ChainA, Extracellular Protein 6 [Fulvia fulva],4B9H_A Chain A, Extracellular Protein 6 [Fulvia fulva]
3NE8_A	1.13e-08	6	73	7	76	Thecrystal structure of a domain from N-acetylmuramoyl-l-alanine amidase of Bartonella henselae str. Houston-1 [Bartonella henselae]
5EMI_A	8.30e-08	6	183	7	177	ChainA, Cell wall hydrolase/autolysin [Nostoc punctiforme PCC 73102]
4UZ2_A	1.32e-06	193	238	1	46	Crystalstructure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_D Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ3_A Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O07532	5.86e-30	193	355	90	288	Peptidoglycan endopeptidase LytF OS=Bacillus subtilis (strain 168) OX=224308 GN=lytF PE=1 SV=2
O31852	2.04e-28	197	357	90	275	D-gamma-glutamyl-meso-diaminopimelic acid endopeptidase CwlS OS=Bacillus subtilis (strain 168) OX=224308 GN=cwlS PE=1 SV=1
P54421	1.05e-27	199	354	30	196	Probable peptidoglycan endopeptidase LytE OS=Bacillus subtilis (strain 168) OX=224308 GN=lytE PE=1 SV=1
Q8CMN2	2.98e-22	170	352	3	192	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=sle1 PE=3 SV=1
Q5HRU2	2.98e-22	170	352	3	192	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=sle1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000496_00911.