CAZyme Information: MGYG000000497_00502

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; QALA01
• CAZyme ID: MGYG000000497_00502
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
387		42955.95	9.2972

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000497	1155652	MAG	Fiji	Oceania

• Gene Location: Start: 469; End: 1632 Strand: +

Full Sequence      

MSDNRLSSIDLSPDSGGPCDVLFVAGEHSGDEQAARMLKAAIAENPSLRACAFGGKALES
AGAKLLFDMTAYSVVGLFEVLKNYSFFAELSDRVVRWIKNNKPRAVCFVDYPGFNLRIAD
RLRREGVSLKGGGNIKVLYYISPQIWAWKSRRRFKIAECVDALGVIFPFEPKCYSDTGLK
ADFVGHPFLDESYVPHVRYDPKGSLLLLSGIRRAAVGRIFPVMLEVMSRFPQENAIAFYP
SLAIKEQLERILEKFPKLYGKVKLLDSSQNKVGVKAAMMSSGTMSLECSLEGIPGVIVYK
ANPLTYLCGRAIVKISYLSIANIILDAPAWREYIQFAANPNKIAQYMERVLYSPEARNEA
ELNAGKLREALKAPANMSAAEWLVKNL

Enzyme Prediction     

No EC number prediction in MGYG000000497_00502.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	22	371	7.8e-91	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	2.12e-88	21	381	4	369	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.39e-82	21	372	4	363	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.23e-73	21	345	1	333	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	8.95e-60	21	380	8	378	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	6.57e-49	66	372	42	333	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATC65221.1	1.64e-130	9	387	8	382
QYY34968.1	1.23e-125	20	383	11	379
QYM79894.1	3.50e-125	10	383	7	376
ACB75370.1	1.67e-124	8	387	6	387
AKC82833.1	3.85e-122	20	385	20	381

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	4.28e-36	18	385	6	379	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	4.28e-36	18	385	6	379	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5ZVR9	3.33e-54	21	373	7	364	Lipid-A-disaccharide synthase 1 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) OX=272624 GN=lpxB1 PE=3 SV=1
Q3JAC1	7.06e-54	21	387	8	378	Lipid-A-disaccharide synthase OS=Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107) OX=323261 GN=lpxB PE=3 SV=1
B6J161	7.55e-54	21	371	6	357	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1
A9KC41	7.55e-54	21	371	6	357	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain Dugway 5J108-111) OX=434922 GN=lpxB PE=3 SV=1
Q83DS5	1.06e-53	21	371	6	357	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) OX=227377 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000497_00502.