CAZyme Information: MGYG000000497_00956

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; QALA01
• CAZyme ID: MGYG000000497_00956
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
336		36948.95	5.049

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000497	1155652	MAG	Fiji	Oceania

• Gene Location: Start: 13; End: 1023 Strand: +

Full Sequence      

MCSSDLGRSASIFTIHNLQHQGIFDRGVLEYAGISMREFRQDSCESMGMLNMLKGGLYNA
TKITTVSPTYAKEIRTSEYGCGLDGVLRFRAADLIGILNGIDVKEWNPASDKLIPANYDV
SSPDGKAVCKAALQERMGLKNDPKIPVFGVVSRLYDQKGLDLLARIAQPLVDNMSIQIAV
LGSGEPWLEGAFKSLTAANPGKIGSYIGYDNELSHLIEAGSDFFLMPSRFEPCGLNQMYS
MRYGTLPIVRSTGGLADTVSQYVEGTGQGDGFLFDSATCDALYNTIGWACSTWYDRPSDI
LSLRRNAMNKDFSWEVSAKSYEQVYKWAIESRTAAF

Enzyme Prediction     

No EC number prediction in MGYG000000497_00956.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	7	326	7.2e-130	0.6716101694915254

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00654	glgA	1.20e-176	11	326	149	461	glycogen synthase GlgA.
cd03791	GT5_Glycogen_synthase_DULL1-like	5.50e-173	10	327	159	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
TIGR02095	glgA	3.95e-155	10	326	156	471	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG0297	GlgA	1.07e-131	11	329	160	479	Glycogen synthase [Carbohydrate transport and metabolism].
PRK14099	PRK14099	1.25e-120	8	334	158	485	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYY36012.1	1.38e-149	3	332	161	490
ADE54149.1	2.27e-141	6	336	163	493
AKC83328.1	1.97e-136	6	332	161	488
AHF91146.1	7.93e-136	6	332	163	489
AOS44572.1	9.91e-128	6	332	168	494

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3D1J_A	6.75e-82	7	325	151	473	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	8.35e-82	7	325	151	473	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	6.56e-81	7	325	151	473	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
4HLN_A	9.30e-73	9	329	293	626	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]
1RZU_A	1.01e-72	11	329	158	476	ChainA, Glycogen synthase 1 [Agrobacterium tumefaciens],1RZU_B Chain B, Glycogen synthase 1 [Agrobacterium tumefaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q74ED9	8.87e-112	6	332	164	489	Glycogen synthase 1 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=glgA1 PE=3 SV=1
Q39XS5	2.35e-109	6	332	164	489	Glycogen synthase 1 OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=glgA1 PE=3 SV=1
Q73MC7	1.39e-105	3	334	155	489	Glycogen synthase OS=Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104) OX=243275 GN=glgA PE=3 SV=1
A7H6L1	3.68e-93	6	326	153	470	Glycogen synthase OS=Anaeromyxobacter sp. (strain Fw109-5) OX=404589 GN=glgA PE=3 SV=1
B8J8R4	5.50e-93	6	332	154	477	Glycogen synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000497_00956.