CAZyme Information: MGYG000000499_01117

Basic Information

• Species: HGM11416 sp900768525
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; HGM11416; HGM11416 sp900768525
• CAZyme ID: MGYG000000499_01117
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
548		61442.21	5.322

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000499	2647539	MAG	Fiji	Oceania

• Gene Location: Start: 10763; End: 12409 Strand: +

Full Sequence      

MKHISYFLPKKIVIAEGEIYNEQSLLRKKTSQIGLNESDVATVNGKCRLVFDFGEEICGC
VRILVHYANDIEPVRIRFGESLTESITPLGVKNATNDHSARDFLADIPQLSDGRFGQTGF
RYVCLEFSGGTYRIKKIVAESESDYPFVYGSFECSDSRVNDIYSVACKTLFLCLQNYMIW
DGIKRDRLVWIGDLHPETLGLLYTTGDIENIENCLDFSVNGTPPTEWMNGLTSYSFWWII
ILYDYYRFTGKREIIEKYADYLYKLVKNTEKLIGEDGSTAFPNDFLDWPTNGTKDAPEGV
AALCKIACERAVELLKIAGKDATKAERAAAKLSKRKHPELSFKQAEAMRYLAYKNNGETV
GKALTAGGAKGMSTFMSYYILTAVTQIMGAKNALDMMKEYYGGMLDKGATTFWEDFDVDW
IEGSGRIDEIPAAGKKDIHGDYGRYCYTGFRHSLCHGWSCGPIEFLVENILGVNVLETGF
KKISVSPDLCGMEYAKGDIPTPYGTIKISHTATENGIKTQIVCPEEIEVIATNCDCDVKR
VKIEKITI

Enzyme Prediction     

No EC number prediction in MGYG000000499_01117.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	48	528	5.2e-80	0.9742063492063492

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	3.63e-14	150	470	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	3.40e-04	472	525	1	55	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG3408	GDB1	0.001	235	335	341	456	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBM20341.1	1.49e-130	6	533	28	568
QZE13938.1	3.03e-128	5	530	26	566
ACU04507.1	2.22e-126	6	530	32	571
QNL50446.1	2.24e-125	5	530	41	579
ATP57578.1	3.41e-122	6	530	43	583

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	4.81e-31	49	508	194	674	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	2.84e-12	49	466	95	538	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000499_01117.