CAZyme Information: MGYG000000500_02161

Basic Information

• Species: CAG-110 sp900547405
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-110; CAG-110 sp900547405
• CAZyme ID: MGYG000000500_02161
• CAZy Family: GT4
• CAZyme Description: D-inositol-3-phosphate glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
422		47667.73	8.1746

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000500	2379768	MAG	Fiji	Oceania

• Gene Location: Start: 439; End: 1707 Strand: +

Full Sequence      

MRLLWLCNLLPGAIRQAVTGAEGSGLWMDQTLAGLRREEDLELRLLCRGDKPAAGTAARN
LSYYIFPEPTVYRYQQDLEQQFTDQLRAYQPDVIHIWGTEYGHTLAMLRVCHRLGLLDRT
VVSIQGLCSVYARHYAEGIPASVYWSTTLRDLLRLDNIPAQQRKYVQRGRMELEALGLAR
HVIGRTPWDKACTQALAEKAQYHFCNESLREPFYEGQWRLGACRKHRIFASSLETPIKGF
HYLLEALTQVLRRYPDATLAVPGKSFFPPDPKAALKQQTYHRYLCRYARAHGLEGKIEFL
GFLSPEDMKREFLQSHVFALPSTVENSPNALGEAMLLGVPCVAAHVGGVSTLLKDREEGF
LYPSTEPLLLASAICRVFDMEEGAASLGRAAQAHAQVTHDPEANLRILRSIYDRLQKGAK
EP

Enzyme Prediction     

No EC number prediction in MGYG000000500_02161.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	235	382	1.5e-23	0.8375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	8.74e-33	2	412	1	365	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	4.73e-29	36	418	30	380	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam13692	Glyco_trans_1_4	1.42e-25	228	379	5	137	Glycosyl transferases group 1.
pfam00534	Glycos_transf_1	2.97e-25	228	394	6	158	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
cd03807	GT4_WbnK-like	3.12e-22	236	413	201	362	Shigella dysenteriae WbnK and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. WbnK in Shigella dysenteriae has been shown to be involved in the type 7 O-antigen biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYF84824.1	4.15e-112	1	415	1	419
QII82417.1	2.74e-107	1	415	1	418
QRN85475.1	1.26e-100	1	412	1	415
AIQ20126.1	9.75e-100	1	415	1	414
AZV55534.1	3.77e-99	1	417	1	415

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XSO_A	1.01e-09	219	400	200	369	ChainA, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSO_B Chain B, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSP_A Chain A, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSP_B Chain B, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSR_A Chain A, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSR_B Chain B, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSU_A Chain A, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSU_B Chain B, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B1VS68	1.60e-08	228	396	278	441	D-inositol 3-phosphate glycosyltransferase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) OX=455632 GN=mshA PE=3 SV=1
Q59002	4.11e-08	238	379	221	348	Uncharacterized glycosyltransferase MJ1607 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1607 PE=3 SV=1
P46915	2.90e-07	237	414	203	375	Spore coat protein SA OS=Bacillus subtilis (strain 168) OX=224308 GN=cotSA PE=1 SV=1
C9ZH13	4.53e-07	228	396	251	414	D-inositol 3-phosphate glycosyltransferase OS=Streptomyces scabiei (strain 87.22) OX=680198 GN=mshA PE=3 SV=1
D6Z995	6.04e-07	236	395	266	416	D-inositol 3-phosphate glycosyltransferase OS=Segniliparus rotundus (strain ATCC BAA-972 / CDC 1076 / CIP 108378 / DSM 44985 / JCM 13578) OX=640132 GN=mshA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.251055	0.747669	0.000464	0.000300	0.000247	0.000252

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000500_02161.