CAZyme Information: MGYG000000501_00515

Basic Information

• Species: CAG-127 sp900553925
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-127; CAG-127 sp900553925
• CAZyme ID: MGYG000000501_00515
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
827	MGYG000000501_2|CGC2	94712.89	6.1338

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000501	2730672	MAG	Fiji	Oceania

• Gene Location: Start: 193942; End: 196425 Strand: +

Full Sequence      

MNQDYLFKQIRKGVTASRQIVVTGYCTAEFMEGKKTKAVLVRNGAQTELACVYTVEQAPA
FNQTKKKGKTFSRVLTICVDVSVRIEAADLLQIWVEASDSDDRMKLCDAKGKEIIKLLQG
INCNVDIVKEEAGVFAIRGWAIDYEEIGILLKDRTSGEVLVLPENTPEWYIRSDAMRKFT
ECDQPRKIGFSMKLPVEWAQRSLEIRFQAGKSEYKEDLKKTGEGVGGRYLNNLYVNLLRV
YNNTKTFGLRNTCVKIKRHLQVATPFSHKDYNKWAHKKMAGAKELEKQRQTKFTYTPKFS
ILVPLYESDEKFLADLIASVQAQTYPEWELCFSDGSRDHTRLQKLLTEYGKKDERIRYTA
RQAGPLGISENTNQAYEIATGDYIVLGDHDDLFTPDALFECVQALNEEHVQVIYTDEDKT
DETGKRFFSPNFKPDFNIDLLRCNNYICHMFVAEKTLVEKVGLFDPAFNGAQDYDFIFRC
IEQAKGIRHIPRVLYHWRAHTVSTAEIPESKIYAFEAGKRAIAAHLKRVGLDGIVEDGDN
LGFYKVSYPVKGEPLVSIVIPNKDHISDLKKCMKAIDERSTYRNLEYVIVENNSEKQETF
AYYKELERREDVNVLYWPDEFNYSKINNYGVEHAKGEYILLLNNDTEMINDDCLEQMLGY
CQREDVGIVGARLYYDDNTIQHAGVIVGFGGVAGHAFVTLNEDDGLYQSRTKVACDYSAV
TAACMMVKKKVFKEVGGLEPEFKVAFNDVDFCMKVRRTGKLVVYVPQAMLYHYESKSRGL
EDTPDKQVRFNNEVELFIKRWPEILADGDPYYNVNLALDAADFSIRV

Enzyme Prediction     

No EC number prediction in MGYG000000501_00515.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	300	452	1.6e-21	0.9352941176470588
GT2	557	735	2.9e-19	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	1.33e-89	297	499	1	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	7.29e-39	558	774	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	2.55e-26	552	802	1	249	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06433	GT_2_WfgS_like	1.31e-24	300	504	1	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	2.46e-20	300	449	1	153	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL99673.1	8.69e-299	233	826	4	595
QWT54406.1	1.02e-262	450	827	1	378
QBE99396.1	1.94e-247	81	826	85	814
QIB58019.1	7.13e-245	81	826	85	814
QMW77451.1	7.13e-245	81	826	85	814

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	2.74e-134	297	823	366	895	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	9.45e-88	265	826	287	841	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q58457	1.08e-10	297	515	8	231	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2
P71057	1.70e-07	296	518	3	230	Putative glycosyltransferase EpsH OS=Bacillus subtilis (strain 168) OX=224308 GN=epsH PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000078	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000501_00515.