CAZyme Information: MGYG000000501_00978

Basic Information

• Species: CAG-127 sp900553925
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-127; CAG-127 sp900553925
• CAZyme ID: MGYG000000501_00978
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
309		35899.35	8.0352

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000501	2730672	MAG	Fiji	Oceania

• Gene Location: Start: 16899; End: 17828 Strand: -

Full Sequence      

MKKVAAIVVTYNRKELLRECLQALLAQTIPDLDILLIDNASTDGTKEYITDIVEENPSIS
YMNTGSNLGGAGGFHYGLKKAYEMGYDYMWIMDDDTIPYPDALEQLFIADKKLKGRYGFL
SSCVLWTDGSYCNMNKPTLDQKCSVDEYEMLGQGVIRACRATFVSLLFKRKTIERVGLPL
KQYFIWGDDQEYTLRISRRIPSYFVTDSRVVHKMKNNKGSDISVDDYERIDRYELAFRND
GCTAYRNGIMYIISYFELVAYMYKKILCEKGNGYKCKRMWVLTKGFVKGLFFRPQIEYVD
EKRKKQNED

Enzyme Prediction     

No EC number prediction in MGYG000000501_00978.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	6	106	2e-26	0.5764705882352941

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04185	GT_2_like_b	1.93e-78	6	239	1	198	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	3.47e-39	1	294	2	295	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
133029	cd04186	1.23e-25	7	213	2	165	GT_2_like_c Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	2.63e-25	7	106	3	99	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	4.29e-24	6	112	1	104	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWT54170.1	6.02e-200	1	304	4	307
ARR37379.1	4.51e-103	1	302	1	299
APG75322.1	9.06e-103	1	302	1	299
APG72354.1	9.06e-103	1	302	1	299
ASW11210.1	9.06e-103	1	302	1	299

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3BCV_A	1.59e-06	3	63	6	66	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0R5Z2	2.07e-13	4	198	7	203	Galactofuranosyltransferase GlfT1 OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=glfT1 PE=1 SV=1
P9WMX2	4.45e-12	2	198	3	200	Galactofuranosyltransferase GlfT1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=glfT1 PE=3 SV=1
P9WMX3	4.45e-12	2	198	3	200	Galactofuranosyltransferase GlfT1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=glfT1 PE=1 SV=1
Q57022	8.02e-08	1	261	3	242	Uncharacterized glycosyltransferase HI_0868 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0868 PE=3 SV=1
C5CBV8	1.37e-07	3	109	2	107	Undecaprenyl-phosphate mannosyltransferase OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) OX=465515 GN=Mlut_12000 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000501_00978.