CAZyme Information: MGYG000000501_01821

Basic Information

• Species: CAG-127 sp900553925
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-127; CAG-127 sp900553925
• CAZyme ID: MGYG000000501_01821
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
328	MGYG000000501_11|CGC2	36590.39	4.5253

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000501	2730672	MAG	Fiji	Oceania

• Gene Location: Start: 69778; End: 70764 Strand: +

Full Sequence      

MQEKKRDYEIYWPHVILVGAIALVLVLIGVVIGVNIGARNKKQPVPVTGNGYTWTLQPGA
EAQMIYANFWQFARASYVLVGDIPNCEFYKIVKEVPRNDFQTDNFAMDEGDSTLMYYHGD
DGSRLSALAVDVSSYQTPLDWEALKRAGVSIAFIRVGFRGYGSEGKLVADEMFQTHIEAA
KAAGLKVGIYFYSQALNYEEGVAEAQYALSLASAYTLDMPVAIDTEEVYADGARTADLSV
DARTDGVVGFCETVKNAGYTPMIYSNRNWFVQKLDMTRLGSYKLWLAHYANQPDFPYLYS
GWQYTGEGTIAGIDQKLDLNVWMEGSVY

Enzyme Prediction     

No EC number prediction in MGYG000000501_01821.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	130	313	2.3e-45	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	3.45e-73	130	323	4	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	4.21e-38	130	322	3	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	5.53e-33	130	313	1	180	Glycosyl hydrolases family 25.
cd06525	GH25_Lyc-like	3.01e-32	130	320	3	182	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
COG3757	Acm	2.65e-26	89	321	36	252	Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL99368.1	4.24e-207	2	328	3	329
QWT52701.1	7.87e-205	1	328	1	328
CBK83179.1	7.15e-78	16	324	15	321
QYX28904.1	1.54e-63	90	321	55	283
QRO38911.1	2.98e-63	90	324	55	286

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1JFX_A	1.69e-10	130	320	8	200	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25310	1.99e-09	130	320	85	277	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1
Q8T2I5	2.03e-06	130	326	24	219	Probable GH family 25 lysozyme 3 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0276439 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999985	0.000040	0.000000	0.000000	0.000000	0.000006

TMHMM  Annotations     

start	end
12	34