CAZyme Information: MGYG000000502_00136

Basic Information

• Species: Brachyspira aalborgi
• Lineage: Bacteria; Spirochaetota; Brachyspirae; Brachyspirales; Brachyspiraceae; Brachyspira; Brachyspira aalborgi
• CAZyme ID: MGYG000000502_00136
• CAZy Family: GT10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367		43941.36	9.2241

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000502	2577668	MAG	Fiji	Oceania

• Gene Location: Start: 8308; End: 9411 Strand: +

Full Sequence      

MNKNFMNYLVWIIPIRSLRDKARCKIIESFTAINFCYWVNYQTYKNKVKNKKTFFVRSDW
HTEEKDFYKNYFYNVIKNNYIPDLEISYKPDIEIFGPVRKRIFLEKSKAKIKIFYTEECV
SKKAKDKIWREYSDNCINHVDLSLCFDRLDENKYKNYVRFPNWINCHFNTIWGGGILNLN
YTKNDIKKVIDNINNAKSKKNKFASLVASHDAPKIRTEIFNKINKIGEVKCAGKLLHNDD
TLKNEFNNNKIEYLRDFKFNICPENTISDGYITEKLFDSFKAGCIPIYSGDENIELDLIN
KNALLFYRRGEDNSELLKEVERLNKDDKSFDAFQNQVKINDSMVDYLWERREKILNRLEE
LINERLK

Enzyme Prediction     

No EC number prediction in MGYG000000502_00136.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT10	166	337	1.4e-35	0.44668587896253603

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00852	Glyco_transf_10	0.001	200	287	1	86	Glycosyltransferase family 10 (fucosyltransferase) C-term. This is the C-terminal domain of a family of fucosyltransferases. This enzyme transfers fucose from GDP-Fucose to GlcNAc in an alpha1,3 linkage. This family is known as glycosyltransferase family 10. The C-terminal domain is the likely binding-region for ADP (manuscript in publication).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASJ20480.1	1.82e-183	1	367	7	366
ACN82649.1	2.21e-177	1	367	7	366
QTM09694.1	3.13e-177	1	367	7	366
QTM12320.1	3.13e-177	1	367	7	366
QTM07027.1	3.13e-177	1	367	7	366

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2NZW_A	2.20e-10	203	302	182	277	CrystalStructure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_C Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZX_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZY_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori]
5ZOI_A	1.44e-09	203	302	182	277	CrystalStructure of alpha1,3-Fucosyltransferase [Helicobacter pylori],5ZOI_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O30511	1.58e-09	203	302	182	277	Alpha-(1,3)-fucosyltransferase FucT OS=Helicobacter pylori OX=210 GN=fucT PE=1 SV=1
Q6A1G3	2.72e-08	211	333	214	342	Alpha-(1,3)-fucosyltransferase 10 OS=Xenopus tropicalis OX=8364 GN=fut10 PE=2 SV=1
Q6NTZ6	3.52e-07	211	333	212	340	Alpha-(1,3)-fucosyltransferase 10 OS=Xenopus laevis OX=8355 GN=fut10 PE=2 SV=2
Q5F2N3	4.61e-07	211	327	204	326	Alpha-(1,3)-fucosyltransferase 10 OS=Danio rerio OX=7955 GN=fut10 PE=2 SV=3
Q6P4F1	2.61e-06	211	333	222	350	Alpha-(1,3)-fucosyltransferase 10 OS=Homo sapiens OX=9606 GN=FUT10 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000032	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000502_00136.