CAZyme Information: MGYG000000502_00490

Basic Information

• Species: Brachyspira aalborgi
• Lineage: Bacteria; Spirochaetota; Brachyspirae; Brachyspirales; Brachyspiraceae; Brachyspira; Brachyspira aalborgi
• CAZyme ID: MGYG000000502_00490
• CAZy Family: GT30
• CAZyme Description: 3-deoxy-D-manno-octulosonic acid transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
420		48794.29	8.6364

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000502	2577668	MAG	Fiji	Oceania

• Gene Location: Start: 2119; End: 3381 Strand: -

Full Sequence      

MIFIYAIYVILMYLFYPLIFIVFSIMMLFNKPIRKGALSRLGFIYPKENNKNAIWIHAVS
VGEIVAVKEIVFYLVEKGYSVYLSTTTVGGYDIAKKNYGDKVELFYLTLDYPNMINKLIK
LISPEYVMITEIEIWPSMIYCLHKKLIPLYMINGRIGKKEIKGYKNFQFFFKPYFNMYRK
ILAQSQIDKKNMIKIGMPESLITVTGNLKYDINYSVNEEKIDDLESRIPANKFVITVGSS
HSNEEEIILKAINSLGIKENIFIVIVPRDINRGNEIKEIAAKLGYNLPLYMEYETNSEDG
IIINTIGELLNWYKLSDLVIMGGTFIGNVGGHNILEAIYFKKPVIIGRYMYNFIEIYEYM
KECVFNCEDKNKLAEVIKYAYENEYIRDSISEKAYNLLIQNNGASKRTMDIINKFQGIQN

Enzyme Prediction     

No EC number prediction in MGYG000000502_00490.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT30	39	212	1.4e-50	0.9661016949152542

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK05749	PRK05749	6.60e-107	7	415	5	420	3-deoxy-D-manno-octulosonic-acid transferase; Reviewed
COG1519	KdtA	1.29e-93	8	415	5	418	3-deoxy-D-manno-octulosonic-acid transferase [Cell wall/membrane/envelope biogenesis].
pfam04413	Glycos_transf_N	4.76e-62	40	212	3	176	3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase). Members of this family transfer activated sugars to a variety of substrates, including glycogen, fructose-6-phosphate and lipopolysaccharides. Members of the family transfer UDP, ADP, GDP or CMP linked sugars. The Glycos_transf_N region is flanked at the N-terminus by a signal peptide and at the C-terminus by Glycos_transf_1 (pfam00534). The eukaryotic glycogen synthases may be distant members of this bacterial family.
cd03801	GT4_PimA-like	2.17e-05	62	413	15	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	7.15e-04	138	420	112	379	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANN62707.1	5.04e-245	6	418	7	419
QTM09705.1	7.16e-245	6	418	7	419
ACN82660.1	7.16e-245	6	418	7	419
QTM04481.1	7.16e-245	6	418	7	419
AUJ50984.1	7.16e-245	6	418	7	419

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XCI_A	2.64e-19	45	378	31	339	Membrane-embeddedmonofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_B Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_C Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_D Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCU_A Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_B Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_C Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_D Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus]
4BFC_A	5.33e-14	231	415	41	230	ChainA, 3-DEOXY-D-MANNO-OCTULOSONIC-ACID TRANSFERASE [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P44806	9.58e-50	54	415	53	422	3-deoxy-D-manno-octulosonic acid transferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=waaA PE=1 SV=1
Q8R6G8	6.48e-42	39	401	27	409	Bifunctional glycosyltransferase/methyltransferase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355) OX=190304 GN=trmB PE=3 SV=1
P0AC77	3.98e-39	34	415	32	419	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli O157:H7 OX=83334 GN=waaA PE=3 SV=1
P0AC76	3.98e-39	34	415	32	419	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=waaA PE=3 SV=1
P0AC75	3.98e-39	34	415	32	419	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli (strain K12) OX=83333 GN=waaA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	29