CAZyme Information: MGYG000000502_01433

Basic Information

• Species: Brachyspira aalborgi
• Lineage: Bacteria; Spirochaetota; Brachyspirae; Brachyspirales; Brachyspiraceae; Brachyspira; Brachyspira aalborgi
• CAZyme ID: MGYG000000502_01433
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
497	MGYG000000502_19|CGC1	56611.31	5.3477

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000502	2577668	MAG	Fiji	Oceania

• Gene Location: Start: 47753; End: 49246 Strand: +

Full Sequence      

MPKLKVMIAASEAVPFIKTGGLADVSGSLPIYLKKFGVEAFVVIPKYRDIDFKDCYLENV
LPTMCVRMGNGEEWCSVFKTVYNEVDFYFIEHHNFFSREGLYHDNVFNDYQDNAWRFGFF
SMAALQLCRDLKLDIDIAHVNDWQTAAIPAYIKTWHWSNELGRAASLLTIHNANYQGIYN
SSTTYDYLGLGWNNYSPDTFEDHGNINLLKGGIFFSDVVTTVSPTYAKEISSPYGGHGMA
PYLQNKTTSFFGILNGIDENVWNPEKDKFIPANFSDKNMKGKKICKRELQKRFLLEEDDK
VALIGAIGRFVDQKGYQFIASIIDYLMNNMKMQFVILGTGDKGLESFFGDLPKRYPGRVG
SYIGYNNELSHLIEAGADMFVMPSLFEPCGLNQMYSLKYGTIPIVHATGGLEDTVENYNE
ETGEGTGFKFYDATSSALYNTIGWAISVYYDYPERFKKMQLRGMKIDNSWEKSAKEYIKA
YELAIANKRNYDDMCSL

Enzyme Prediction     

No EC number prediction in MGYG000000502_01433.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	5	482	1.2e-175	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02095	glgA	0.0	4	484	1	473	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK00654	glgA	0.0	4	487	1	466	glycogen synthase GlgA.
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	5	482	1	473	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
COG0297	GlgA	8.02e-166	5	487	2	481	Glycogen synthase [Carbohydrate transport and metabolism].
PRK14099	PRK14099	5.56e-118	1	489	1	484	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASJ22411.1	0.0	1	497	1	497
ADG70362.1	0.0	1	497	1	497
AEM22538.1	0.0	1	497	1	497
ANN62785.1	0.0	1	497	1	497
QTM04407.1	0.0	1	497	1	497

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3D1J_A	1.06e-86	4	481	1	473	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	1.86e-86	4	481	1	473	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	1.44e-85	4	481	1	473	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
1RZU_A	4.39e-84	4	486	1	477	ChainA, Glycogen synthase 1 [Agrobacterium tumefaciens],1RZU_B Chain B, Glycogen synthase 1 [Agrobacterium tumefaciens]
4HLN_A	5.97e-84	6	488	127	629	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q39XS5	1.12e-135	1	488	1	489	Glycogen synthase 1 OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=glgA1 PE=3 SV=1
Q74ED9	4.50e-132	1	488	1	489	Glycogen synthase 1 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=glgA1 PE=3 SV=1
Q73MC7	4.76e-129	4	488	1	487	Glycogen synthase OS=Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104) OX=243275 GN=glgA PE=3 SV=1
A6TSC8	4.80e-122	4	481	1	471	Glycogen synthase OS=Alkaliphilus metalliredigens (strain QYMF) OX=293826 GN=glgA PE=3 SV=1
A6LJ53	1.66e-118	4	488	1	480	Glycogen synthase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) OX=391009 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000502_01433.