CAZyme Information: MGYG000000503_00438

Basic Information

• Species: UMGS1585 sp900766355
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; UMGS1585; UMGS1585 sp900766355
• CAZyme ID: MGYG000000503_00438
• CAZy Family: CE11
• CAZyme Description: UDP-3-O-acyl-N-acetylglucosamine deacetylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
279	MGYG000000503_2|CGC1	31539.55	7.094

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000503	1878889	MAG	Fiji	Oceania

• Gene Location: Start: 124312; End: 125151 Strand: -

Full Sequence      

MATLLNEVKISGNTLMKNHECEVVVKPSNTGEIRIFVEGADKYFVAKVDNVIATDHCVVL
GSKEHRTLLGGYKYQVMLCEHFMAACGILGINSIDVYVSKPEFPVLDGSSKIWVELFKSA
GITKEKRQFYTVSEPVYYLNGKTSLVVLPDKDLTLSYAVNYDFPDLTRRWVAFDKKNIDE
IIEARTFGFYRDLKKFQMLGFARGVNADNTLGLMDDGTYYSELRSEKEPIKHKILDLFGD
FYLTGVSILDMKAQILVKEAGHAVHVKVANELKDKLIKI

Enzyme Prediction     

No EC number prediction in MGYG000000503_00438.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE11	3	273	3.6e-59	0.985239852398524

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03331	LpxC	5.77e-64	3	274	3	271	UDP-3-O-acyl N-acetylglycosamine deacetylase. The enzymes in this family catalyze the second step in the biosynthetic pathway for lipid A.
PRK13186	lpxC	7.71e-61	3	272	6	272	UDP-3-O-acyl-N-acetylglucosamine deacetylase.
COG0774	LpxC	6.31e-52	3	272	6	275	UDP-3-O-acyl-N-acetylglucosamine deacetylase [Cell wall/membrane/envelope biogenesis].
PRK13188	PRK13188	1.61e-39	3	278	7	303	bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed
PRK13187	PRK13187	3.97e-08	80	249	89	270	UDP-3-O-acyl N-acetylglycosamine deacetylase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38878.1	1.69e-114	1	279	36	309
AOP34245.1	3.78e-38	3	269	9	271
ADQ13894.1	5.08e-38	3	277	10	281
AYV54494.1	1.05e-37	3	269	9	271
AMX71062.1	2.06e-37	3	269	9	271

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2GO3_A	9.03e-28	3	275	6	266	ChainA, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],2GO3_B Chain B, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],2GO4_A Chain A, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],2GO4_B Chain B, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus]
1P42_A	9.61e-28	3	275	5	265	ChainA, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],1P42_B Chain B, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],1YH8_A Chain A, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],1YH8_B Chain B, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],1YHC_A Chain A, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],1YHC_B Chain B, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus]
2IER_A	9.81e-28	3	275	6	266	ChainA, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],2IER_B Chain B, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],2IES_A Chain A, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],2IES_B Chain B, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],2J65_A Structure of LpxC from Aquifex aeolicus in complex with UDP [Aquifex aeolicus VF5],2J65_B Structure of LpxC from Aquifex aeolicus in complex with UDP [Aquifex aeolicus VF5],2O3Z_A Chain A, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],2O3Z_B Chain B, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],3P76_A X-ray crystal structure of Aquifex aeolicus LpxC complexed SCH1379777 [Aquifex aeolicus],4U3B_A LpxC from A.Aaeolicus in complex with the MMP inhibitor 4-[[4-(4-chlorophenoxy)phenyl]sulfanylmethyl]tetrahydropyran-4-carbohydroxamic acid - compound 2 [Aquifex aeolicus VF5],4U3D_A LpxC from A.Aaeolicus in complex with 4-[[4-[2-[4-(morpholinomethyl)phenyl]ethynyl]phenoxy]methyl]tetrahydropyran-4-carbohydroxamic acid (compound 9) [Aquifex aeolicus VF5]
3P3C_A	1.04e-27	3	275	5	265	CrystalStructure of the Aquifex aeolicus LpxC/LPC-009 complex [Aquifex aeolicus]
2JT2_A	1.04e-27	3	275	6	266	ChainA, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],5DRO_A Structure of the Aquifex aeolicus LpxC/LPC-011 Complex [Aquifex aeolicus VF5],5DRO_B Structure of the Aquifex aeolicus LpxC/LPC-011 Complex [Aquifex aeolicus VF5],5DRP_A Structure of the AaLpxC/LPC-023 Complex [Aquifex aeolicus VF5],5DRP_B Structure of the AaLpxC/LPC-023 Complex [Aquifex aeolicus VF5]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q04T70	4.12e-38	3	269	9	271	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) OX=355277 GN=lpxC PE=3 SV=1
Q051J2	4.12e-38	3	269	9	271	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) OX=355276 GN=lpxC PE=3 SV=1
Q8F3U4	3.15e-37	3	269	9	271	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) OX=189518 GN=lpxC PE=3 SV=1
Q72RV5	3.15e-37	3	269	9	271	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) OX=267671 GN=lpxC PE=3 SV=2
B0SS82	2.92e-33	3	269	9	272	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) OX=456481 GN=lpxC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000078	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000503_00438.