CAZyme Information: MGYG000000503_01302

Basic Information

• Species: UMGS1585 sp900766355
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; UMGS1585; UMGS1585 sp900766355
• CAZyme ID: MGYG000000503_01302
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
329		36979.25	7.5832

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000503	1878889	MAG	Fiji	Oceania

• Gene Location: Start: 34182; End: 35171 Strand: +

Full Sequence      

MVRKILAVNFGGIGDEILFLPTLWSLKKEYPNASITLALESRAMGIKDLSDIIDDVIPVD
IKTKNKYTEIFNFISKAIFGNYDLLVISGANKMMSIIAACTFIPKRVGFDTGKLSQILLT
DVVKLNKNQYAGKMYHDLVTPLTQQVTELPILSVNIKQKIPNSVLIHPGVSEMSRRKGII
KTIQGYEWAQLIDLLQEAGKHVMIAGGPDDEYCIKEIEKYTKIKNYENLYGKTHNLTELA
ELISSAEKFVCSDSAPLHIAVGLGVKTYVFFGPTDDKKLIPQNDNVIALKNDCDCPDKPC
LWERRKMSCMEVPCLKYDFHTISRVILEN

Enzyme Prediction     

No EC number prediction in MGYG000000503_01302.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	81	301	5e-29	0.8933333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	1.34e-42	2	293	1	301	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	6.42e-41	4	316	1	264	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK10422	PRK10422	3.57e-20	2	287	5	304	lipopolysaccharide core biosynthesis protein; Provisional
pfam01075	Glyco_transf_9	6.91e-19	80	301	11	237	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
TIGR02195	heptsyl_trn_II	1.55e-12	4	275	1	281	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38411.1	4.82e-124	4	328	2	328
BAI93916.1	2.91e-48	4	291	2	300
QNH55727.1	2.91e-48	4	291	2	300
AMW31030.1	2.91e-48	4	291	2	300
CDM95688.1	2.91e-48	4	291	2	300

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9R9D5	7.01e-12	14	287	5	292	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000503_01302.