CAZyme Information: MGYG000000504_00331

Basic Information

• Species: CAG-312 sp000438015
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312; CAG-312 sp000438015
• CAZyme ID: MGYG000000504_00331
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370	MGYG000000504_2|CGC4	43283.52	9.074

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000504	2519783	MAG	Fiji	Oceania

• Gene Location: Start: 84686; End: 85798 Strand: -

Full Sequence      

MEAKTQRRDFLKKTVAAAAFMALGGRLKAAETQRKKPKEVDIPLYRGFNLLNMFVHTWAS
DFEEKDFETIREFGFNFARIPLSYWCWSSEENWFKIDEKALERIDKCVELGGKYGLHVNL
NFHRAPGYCINRWEGKELPKNLFLDLEPLEACAFHWRHFAQRYKGIDNARLSFNLVNEPP
KVPTQNYIRVVRVLTEAIRSEDPSRLIFIDGENSGERALRGVEDIDGIVQSAHGYYPNEI
SQYQASWLKKWINFDKYPADKLSWPFKKGDRIIDKQVLSERYDKGWAEYAKDGGKIHAGE
FGAYCKLPHKIALAYLSDQLSIYKERGWGWALWNLKGTFGVFDSKRKDVVYENYKGMKLD
REMMELLLRS

Enzyme Prediction     

No EC number prediction in MGYG000000504_00331.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	47	336	9.2e-104	0.9965156794425087

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	2.41e-21	46	365	53	392	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	6.74e-17	47	335	7	268	Cellulase (glycosyl hydrolase family 5).
pfam10518	TAT_signal	0.006	7	25	4	22	TAT (twin-arginine translocation) pathway signal sequence.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SCM55578.1	4.48e-132	6	370	2	366
ATP56029.1	3.17e-106	42	367	35	350
ACB73410.1	2.67e-105	7	368	3	363
AFN75855.1	1.73e-104	7	367	3	365
ARA93352.1	2.29e-102	7	367	3	345

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7EC9_A	9.52e-76	42	367	17	338	ChainA, Endoglucanase [Thermotoga maritima MSB8],7EC9_B Chain B, Endoglucanase [Thermotoga maritima MSB8],7EFZ_A Chain A, Endoglucanase [Thermotoga maritima MSB8],7EFZ_B Chain B, Endoglucanase [Thermotoga maritima MSB8]
1VJZ_A	5.98e-74	42	367	17	338	Crystalstructure of Endoglucanase (TM1752) from Thermotoga maritima at 2.05 A resolution [Thermotoga maritima]
3W0K_A	3.37e-70	47	370	5	328	CrystalStructure of a glycoside hydrolase [Caldanaerobius polysaccharolyticus],3W0K_B Crystal Structure of a glycoside hydrolase [Caldanaerobius polysaccharolyticus]
1CEC_A	8.98e-28	64	352	31	333	ChainA, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
1CEN_A	2.36e-27	64	352	31	333	ChainA, CELLULASE CELC [Acetivibrio thermocellus],1CEO_A Chain A, CELLULASE CELC [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A3DJ77	5.13e-28	64	352	31	333	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1
P23340	5.13e-28	64	352	31	333	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1
P0C2S3	4.92e-27	64	352	31	333	Endoglucanase C OS=Acetivibrio thermocellus OX=1515 GN=celC PE=1 SV=1
P16169	2.95e-12	63	327	32	285	Cellodextrinase A OS=Ruminococcus flavefaciens OX=1265 GN=celA PE=3 SV=3
Q876J2	6.25e-08	58	336	111	413	Sporulation-specific glucan 1,3-beta-glucosidase OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) OX=659244 GN=SPR1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as TAT

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	0.000000	0.999964	0.000051	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000504_00331.