CAZyme Information: MGYG000000504_00692

Basic Information

• Species: CAG-312 sp000438015
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312; CAG-312 sp000438015
• CAZyme ID: MGYG000000504_00692
• CAZy Family: GT11
• CAZyme Description: O-antigen biosynthesis glycosyltransferase WbnK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
298	MGYG000000504_5|CGC1	34681.75	9.5053

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000504	2519783	MAG	Fiji	Oceania

• Gene Location: Start: 27114; End: 28010 Strand: -

Full Sequence      

MIIVKVQGGLGNQMFQYAFGRALAEKHSQDLYLDCSEYLRPSCKREYGLDHFNIRAKKAS
CGDVKSMVTPHFALRKKLKKIFAVPYSLSPTHILERNFNFQPSILEFNCGYFDGFWQTQK
YFSGISDIVRKDLTFKDAVKYSGGETFAKITSLNSVSLHIRRGDYVKVKRTRKRFSVIRA
GYFKRAVEYMRSKLDTPHFFIFTDDPKWVSENFPAGEDYTLVSSSGMYEDLFLMAQCRHN
IIFNSSFSWWGAWLNGNPGKIVVAPDMWFTPHYKLDYSDVVPEEWIKLNTGYFESKEF

Enzyme Prediction     

No EC number prediction in MGYG000000504_00692.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT11	1	288	9.7e-77	0.9963768115942029

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11301	Fut1_Fut2_like	3.63e-66	1	269	1	256	Alpha-1,2-fucosyltransferase. Alpha-1,2-fucosyltransferases (Fut1, Fut2) catalyze the transfer of alpha-L-fucose to the terminal beta-D-galactose residue of glycoconjugates via an alpha-1,2-linkage, generating carbohydrate structures that exhibit H-antigenicity for blood-group carbohydrates. These structures also act as ligands for morphogenesis, the adhesion of microbes, and metastasizing cancer cells. Fut1 is responsible for producing the H antigen on red blood cells. Fut2 is expressed in epithelia of secretory tissues, and individuals termed "secretors" have at least one functional copy of the gene; they secrete H antigen which is further processed into A and/or B antigens depending on the ABO genotype. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
pfam01531	Glyco_transf_11	1.05e-28	1	289	1	298	Glycosyl transferase family 11. This family contains several fucosyl transferase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR05185.1	1.32e-71	1	288	1	293
AEI51435.1	5.65e-69	1	288	1	287
QPK64917.1	9.61e-68	1	288	1	289
QWV99047.1	4.82e-63	1	288	1	292
QXE88213.1	4.82e-63	1	288	1	292

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58YV9	1.45e-29	6	288	5	302	O-antigen biosynthesis glycosyltransferase WbnK OS=Escherichia coli OX=562 GN=wbnK PE=1 SV=1
Q866F1	1.72e-12	114	289	167	354	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Saimiri sciureus OX=9521 GN=FUT1 PE=3 SV=1
Q866C5	5.69e-12	114	289	167	354	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Plecturocebus brunneus OX=1812042 GN=FUT1 PE=3 SV=1
Q866F0	5.69e-12	114	289	167	354	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Saimiri boliviensis boliviensis OX=39432 GN=FUT1 PE=3 SV=1
Q866C9	1.03e-11	114	289	167	354	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Lagothrix lagotricha OX=9519 GN=FUT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000504_00692.