CAZyme Information: MGYG000000504_00803

Basic Information

• Species: CAG-312 sp000438015
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312; CAG-312 sp000438015
• CAZyme ID: MGYG000000504_00803
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
759		85687.79	8.172

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000504	2519783	MAG	Fiji	Oceania

• Gene Location: Start: 17758; End: 20037 Strand: -

Full Sequence      

MLKKFIVFIACQLVLIFSALAGEAKWLAPKGENVDRPNCWAAFRKDFKVDSVPQSAKAKI
AADSKYWLWINGKLAVFEGGLKRGPNPNDTYFDEVDIAPFLKKGENKLAMLVWHFGKHGF
SHKNSGKFGMLFELDTDSLKLASDSTWLSKVHPAYSSADNPPPNFRLPESNIKFDANKDI
PGWQTADAKNLLGFEPSMEIGKEGDAPWNRLIKRPTPQWKDFGVRTAVFSRESGHKFDTV
TAELPYNMQMTPIITLNDPRGGNLVDIMTDHTFAGGAQNLRAEYITKKGVQTYESLGWLN
GEKIILNLPKDVKVESVQYRETGYDTELLGRFYCDDDFFAIFWEKAMRTLYINMRDTYFD
CPERERAQWWGDAVVLMGQSFYTYSTSAHALMRKAILELAAWQKQDGALFSPIPAGNYDS
ELPGQMLASIGRYGFWNYYMNTADIDTIKTVYPAVKKYLSLWTLDETGLTAFRKGGWTWG
DWGENRDIRLIFAGWHYIALEAAANMADILNLPDDAKGYREIMSKVKDAYNKCWNGKEYR
HPDYKLLTDDRVQALAVISGIADDSKYPQIKAFLRRNEHASPYMEKYVMESLFKMGDGVY
GLERAKKRFGTMINDKRHTTLFEGWEIGTFGGGSINHAWSGGPITVISQYLCGIYPLEAG
WKTFKIEPYPAGFKRASIEIPSIAGTVKSAFKIDGGEFILNVSVPQGTQAVVYMPEFTKG
KSLSVNGSEDLDKFSSEKFKHASKATLLLPAGEYKISAR

Enzyme Prediction     

No EC number prediction in MGYG000000504_00803.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	283	713	3.5e-85	0.878968253968254
CBM67	24	208	1.5e-31	0.9943181818181818

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.16e-24	330	651	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	4.71e-13	653	729	1	78	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKZ15800.1	0.0	26	756	17	747
ASM67368.1	0.0	3	759	4	749
QQT79846.1	0.0	3	759	3	748
QRP59702.1	0.0	3	759	3	748
QXU44133.1	0.0	19	756	35	776

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNB2	1.19e-10	43	759	177	923	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000303	0.999008	0.000166	0.000189	0.000167	0.000155

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000504_00803.