CAZyme Information: MGYG000000504_01154

Basic Information

• Species: CAG-312 sp000438015
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312; CAG-312 sp000438015
• CAZyme ID: MGYG000000504_01154
• CAZy Family: GH110
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
790		90018.32	7.9179

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000504	2519783	MAG	Fiji	Oceania

• Gene Location: Start: 51756; End: 54128 Strand: +

Full Sequence      

MFRNIFLATIFCLSFNCMFAEQSGEANILSENPFMDTSSYKLPGMSKVSMNDKGTVLSID
TTSSSDQWHKFLEFKPGIFQPNKLYTIEIKYKISEIGDEGMLFFIVRNLKKAENGVIDDL
ASVTPVSTSEKYKVARLIFKTPEDSSDYAFVIHGHKKFKAKVKGLKIFDGFDSSCAYKPS
PDAEPYEAEIKKLPTGCEDFEVALPQPAENAPTLNAKDFGVSEDAAGWENFANLQKAIDE
CKKVKAAKLVLNKGNYKIYNLKNSAPLNFNGMENFEFDASGSTLTFWKSGGAHFDIRNCQ
KVKFSNINIDWNWKDDPIVSIVKIENCGELQDKTKYIDLKFTEYEKFPKRDNLRTAILVT
YNPKDKSRTNDWGIGIALGASKQQGMKYEWLSDNILRMSGPQITRFPEKGKEMFLQHYYY
DRNAFQLYDNKNMTLQNINIYSVPGHAFVVGGTQQYFQFLNVNIKLPPNSDRPKITCSAD
HLHFTRSCGYFKMIGCEFSYGVDDCANFHDCSGFARRHTDYSLMTQNTEGFPKGTKVELR
QGDYSPANFIGTVKETIPVNPAKRVYEVVFEEKLPEQKYDGFVMFNTAYNTHNLLIKDCH
FHDTVCRGLLILCRDTTIENCRFERHNMGALKFETGYTFNVWSEGYGVKNVVVRNCKFYK
SNIAEHKHGGYARDIFMGVYMKKDPTDVGTMYPIISDILIENNIFEESSGLIAYISSTGN
VTIRNNKFINNESMKSDFPYRAGFYVTYSSNTKIVNNTWVQSKYAPYPAVFYDPATTKNL
IAKGNKIISE

Enzyme Prediction     

No EC number prediction in MGYG000000504_01154.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH110	215	757	5.7e-49	0.9945255474452555

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13229	Beta_helix	5.76e-09	588	758	28	157	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam13229	Beta_helix	1.88e-07	589	758	6	133	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
COG5434	Pgu1	3.43e-05	579	757	287	451	Polygalacturonase [Carbohydrate transport and metabolism].
TIGR03804	para_beta_helix	0.001	714	758	3	38	parallel beta-helix repeat (two copies). This model represents a tandem pair of an approximately 22-amino acid (each) repeat homologous to the beta-strand repeats that stack in a right-handed parallel beta-helix in the periplasmic C-5 mannuronan epimerase, AlgA, of Pseudomonas aeruginosa. A homology domain consisting of a longer tandem array of these repeats is described in the SMART database as CASH (SM00722), and is found in many carbohydrate-binding proteins and sugar hydrolases. A single repeat is represented by SM00710. This TIGRFAMs model represents a flavor of the parallel beta-helix-forming repeat based on prokaryotic sequences only in its seed alignment, although it also finds many eukaryotic sequences.
pfam13229	Beta_helix	0.001	696	759	9	64	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44429.1	1.59e-196	49	790	42	770
AVM44109.1	2.88e-192	49	790	83	807
AVM44539.1	3.34e-131	50	789	44	764
AVM46987.1	2.61e-105	57	789	20	746
AZM48752.1	6.74e-87	193	789	39	621

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7JW4_A	1.15e-12	208	729	22	598	Crystalstructure of PdGH110B in complex with D-galactose [Pseudoalteromonas distincta],7JW4_B Crystal structure of PdGH110B in complex with D-galactose [Pseudoalteromonas distincta]
7JWF_A	4.59e-12	208	729	22	598	Crystalstructure of PdGH110B D344N in complex with alpha-(1,3)-galactobiose [Pseudoalteromonas distincta],7JWF_B Crystal structure of PdGH110B D344N in complex with alpha-(1,3)-galactobiose [Pseudoalteromonas distincta],7JWF_C Crystal structure of PdGH110B D344N in complex with alpha-(1,3)-galactobiose [Pseudoalteromonas distincta],7JWF_D Crystal structure of PdGH110B D344N in complex with alpha-(1,3)-galactobiose [Pseudoalteromonas distincta]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5L7M8	1.62e-16	208	753	20	572	Alpha-1,3-galactosidase A OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=glaA PE=3 SV=1
Q64MU6	2.83e-16	208	753	20	572	Alpha-1,3-galactosidase A OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=glaA PE=3 SV=1
B1KD83	2.24e-13	214	760	33	583	Alpha-1,3-galactosidase A OS=Shewanella woodyi (strain ATCC 51908 / MS32) OX=392500 GN=glaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002888	0.502976	0.493178	0.000463	0.000253	0.000228

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000504_01154.