CAZyme Information: MGYG000000504_01575

Basic Information

• Species: CAG-312 sp000438015
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312; CAG-312 sp000438015
• CAZyme ID: MGYG000000504_01575
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
682		76436.2	7.5146

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000504	2519783	MAG	Fiji	Oceania

• Gene Location: Start: 31193; End: 33241 Strand: +

Full Sequence      

MKKILFALICLACLVVVATTCKTEILNAVKKTSAPQGKQPEEIQSESMSKYEKSGMPKFI
MGACTHFWQGKGILEKNVDMLLQAGFNSIRDEATWSSVEKQKGVLSMPPHAEKYLSYASS
KNLNPLLILDYANIFYNGGGYPETPEAIDGFANYAGFMAKNLKGKVKLYQVWNEWDGGCG
MPGFKGKSTAPGYAKLLEKVYAAIKAEDSEALVLLNSICKGDSFFEESLATGVLKNCDVA
TLHTYNYGEQRTFNTAEAWYARMQNIENMLKKYNDGQLKPLIITEMGYPNQTSNAGSTYE
RTAIQAAKIYLLARTLPWLKGIYWYDFQDDGWDSDYNENNFGIIKADFTPKPAYYALKSI
SDIVKNADFEGFEKTPVSSLKILKFKLRGKDVYALWNIDENTEIQVTLKNSAEVKTDIEA
FTAGGISQKRQWGRRDFLKDRNVKSETDTITFCVGMMPLILKGDFSNVKILSTKPVAYNA
LHTQKQLPRIMYSVPRTPFESDAQDFSYNTILPWQPVKEVFSGKDDLSANFKASYQPDAL
NFTISVVDQTHFVNSKKPELSDYAQIFLKIPEPHAQSLSATVLLDNGEVKILCDSDKFSR
DKSLIKSEATRDQNTTIYKISLSPKLFGLKSFERGMAIGCGILVNDNDNENEPLSNQPML
RWSNAPGRNSTDTSKLNALILD

Enzyme Prediction     

No EC number prediction in MGYG000000504_01575.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	134	363	3.1e-22	0.568445475638051

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	9.09e-10	498	648	2	160	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
cd19608	GH113_mannanase-like	3.27e-06	254	353	201	302	Glycoside hydrolase family 113 beta-1,4-mannanase and similar proteins. Mannan endo-1,4-beta mannosidase (E.C 3.2.1.78) randomly cleaves (1->4)-beta-D-mannosidic linkages in mannans, galactomannans and glucomannans and is also called beta-1,4-mannanase, endo-1,4-beta-mannanase, endo-beta-1,4-mannase, beta-mannanase B, beta-1, 4-mannan 4-mannanohydrolase, endo-beta-mannanase, beta-D-mannanase, 1,4-beta-D-mannan mannanohydrolase, and 4-beta-D-mannan mannanohydrolase. (1->4)-beta-linked mannans are polysaccharides with a linear polymer backbone of (1->4)-beta-linked mannose units (in plants and fungi) or alternating mannose and glucose/galactose units (glucomannan in plants and fungi, and galactomannan and galactoglucomannan in plants), such as in the hemicellulose fraction of hard- and softwoods. Complete degradation of mannan requires a series of enzymes, including beta-1,4-mannanase. According to the CAZy database beta-1,4-mannanases are grouped into various glycoside hydrolase (GH) families; GH family 113 beta-1,4-mannanases include mostly bacterial and archaeal sequences.
smart00633	Glyco_10	0.003	264	357	173	263	Glycosyl hydrolase family 10.
pfam06452	CBM9_1	0.003	513	681	13	181	Carbohydrate family 9 binding domain-like. CBM9_1 is a C-terminal domain on bacterial xylanase proteins, and it is tandemly repeated in a number of family-members. The CBM9 module binds to amorphous and crystalline cellulose and a range of soluble di- and monosaccharides as well as to cello- and xylo- oligomers of different degrees of polymerization. Comparison of the glucose and cellobiose complexes during crystallisation reveals surprising differences in binding of these two substrates by CBM9-2. Cellobiose was found to bind in a distinct orientation from glucose, while still maintaining optimal stacking and electrostatic interactions with the reducing end sugar.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM46868.1	7.00e-121	57	667	22	627
QCQ20833.1	4.39e-71	54	418	36	398
QIJ00692.1	6.20e-56	59	404	26	369
AEJ04930.1	9.24e-56	59	406	32	377
BAP80074.1	1.62e-55	59	419	32	388

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JVK_A	2.23e-30	61	406	106	457	Structuralinsights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_B Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_C Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000461	0.252685	0.746587	0.000081	0.000091	0.000088

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000504_01575.