CAZyme Information: MGYG000000505_00966

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae
• CAZyme ID: MGYG000000505_00966
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373		42700.9	6.9121

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000505	1142930	MAG	Fiji	Oceania

• Gene Location: Start: 26; End: 1147 Strand: +

Full Sequence      

MYGYFDDAERFSFFSRAILEMLPHIKFRPDIIHANDWQSALVPVYFSAFYAQNEFYSNMK
TIFTIHNIEYQGKYGYEVFNDLIGLNQKDISLLDFDGCINFMKGAIETANVVTTVSPTYS
QEILNDWFAHGLAPILNARSYKLHGILNGIDTELYHPSTDPLIYKTYSEKHLSDKVKNKI
LLQDRLHLDKSESVPVIGMVTRLVEHKGIDLVISALETIMKETNVQFVILGSGEKNYEDF
FSYMQYKYPNRICACHGFVPELAHKIYAGSDMFLMPSKSEPCGLSQMIALRYGSIPIVRE
TGGLKDSVSDSGDGCGVGFRFKKYDPWDMYDSIKRALAGYCIPEGWTKLVKRAMNCNNSW
NHSAKNYLTFYKK

Enzyme Prediction     

No EC number prediction in MGYG000000505_00966.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	2	373	2.2e-143	0.7923728813559322

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	2	373	102	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK00654	glgA	0.0	1	373	91	462	glycogen synthase GlgA.
TIGR02095	glgA	1.82e-157	1	373	99	472	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG0297	GlgA	9.18e-152	2	373	102	477	Glycogen synthase [Carbohydrate transport and metabolism].
PRK14099	PRK14099	7.97e-99	6	372	109	477	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARP51332.1	2.50e-175	1	372	98	469
QKN23272.1	2.50e-175	1	372	98	469
QKO30046.1	2.50e-175	1	372	98	469
QNO18264.1	1.17e-173	1	372	98	469
QNK41915.1	4.90e-173	1	372	98	469

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3D1J_A	4.10e-75	1	371	100	473	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	2.78e-74	1	371	100	473	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
6GNE_A	1.92e-73	2	373	112	496	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]
3COP_A	2.16e-73	1	371	100	473	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
1RZU_A	8.39e-69	4	373	104	474	ChainA, Glycogen synthase 1 [Agrobacterium tumefaciens],1RZU_B Chain B, Glycogen synthase 1 [Agrobacterium tumefaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6TSC8	4.04e-117	2	372	99	472	Glycogen synthase OS=Alkaliphilus metalliredigens (strain QYMF) OX=293826 GN=glgA PE=3 SV=1
B2V049	9.19e-114	1	373	98	474	Glycogen synthase OS=Clostridium botulinum (strain Alaska E43 / Type E3) OX=508767 GN=glgA PE=3 SV=1
A0PY73	7.60e-113	2	371	99	472	Glycogen synthase OS=Clostridium novyi (strain NT) OX=386415 GN=glgA PE=3 SV=1
B7GK04	1.25e-112	1	371	98	471	Glycogen synthase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) OX=491915 GN=glgA PE=3 SV=1
B2TR28	2.09e-112	1	373	98	474	Glycogen synthase OS=Clostridium botulinum (strain Eklund 17B / Type B) OX=935198 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000011	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000505_00966.