CAZyme Information: MGYG000000507_01320

Basic Information

• Species: UBA2903 sp900768875
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-977; UBA2903; UBA2903 sp900768875
• CAZyme ID: MGYG000000507_01320
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
389		42160.94	7.2643

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000507	1876051	MAG	Fiji	Oceania

• Gene Location: Start: 27504; End: 28673 Strand: -

Full Sequence      

MEEKLIYLIAGEPSGDLLASRLMKALREKTDGKVRFAGVGGETMAEQGFESLFDSSELAV
MGLAEVIPSIPRIMARIRQTVDDIVAKKPAVVITVDSWSFSARVNQGLRSLHTGIPQVHY
VAPQVWAWKKGRAKTCGRYIDLLLALLPYEAKYFTPYGLKVDFVGHPVVEGGAAKGNGAA
FRAENGIAENEKLLCVLPGSRRSEIKYLLPVFKDTVALLAQKHPDAKVVVPTVATVQDAV
KAAVREWALPVCVVTGETARYDAFAAADAALAASGTVALELAMAKVPYTIAYKMNPVSSF
LARKLVSGKYANLVNILADREIVKEYLLEDCRPDLLALEVERLLTDEAYKNAEVNGAFDV
LKMLGADGAETPSQKAADAILNLIKENKQ

Enzyme Prediction     

No EC number prediction in MGYG000000507_01320.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	6	362	6.4e-118	0.9858757062146892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.65e-133	6	388	4	379	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	4.39e-129	4	386	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.05e-96	6	354	1	350	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.20e-72	6	354	8	357	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.60e-46	10	351	8	315	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE51288.1	3.28e-140	5	389	2	386
CUW40282.1	4.80e-136	5	389	7	391
ARJ65449.1	1.94e-135	5	389	7	391
QIM10250.1	3.40e-129	6	386	7	386
AUN29831.1	9.37e-129	1	385	1	385

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	3.23e-59	6	385	9	382	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	4.55e-59	6	385	9	382	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2W4D7	6.56e-141	5	389	2	386	Lipid-A-disaccharide synthase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) OX=342108 GN=lpxB PE=3 SV=1
B6IST7	1.64e-126	1	384	1	383	Lipid-A-disaccharide synthase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) OX=414684 GN=lpxB PE=3 SV=1
Q5FUA3	6.93e-91	4	386	29	407	Lipid-A-disaccharide synthase OS=Gluconobacter oxydans (strain 621H) OX=290633 GN=lpxB PE=3 SV=1
Q0BS63	5.69e-90	1	380	1	378	Lipid-A-disaccharide synthase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) OX=391165 GN=lpxB PE=3 SV=1
Q3SRI5	1.98e-85	6	388	13	393	Lipid-A-disaccharide synthase OS=Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255) OX=323098 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000507_01320.