CAZyme Information: MGYG000000509_00724

Basic Information

• Species: CADBRU01 sp900762815
• Lineage: Bacteria; Elusimicrobiota; Elusimicrobia; Elusimicrobiales; Elusimicrobiaceae; CADBRU01; CADBRU01 sp900762815
• CAZyme ID: MGYG000000509_00724
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364	MGYG000000509_6|CGC1	40586.33	9.8469

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000509	1316319	MAG	Fiji	Oceania

• Gene Location: Start: 17830; End: 18924 Strand: -

Full Sequence      

MNRRFIIASGGTGGHFYPGFALGRLLNKQNCSVLFVVRKDDPAIRVLQENKLKYQEIDLC
SFPRSLNPFKQLAFACKLWGALRQTRQILRQFKPDVAVGTGGYISFPLIFSAHCMGIKTV
VHDSNTKIGLSNRICSHFTNLFLLGLPVTRPLPHAQLVGTPIRREFAEPVDRAQTLTQLG
LNPDFKTVLLFGGSQGARSLNQALIAAVKQLVAENERLQFIHISGERWYQSISNRYGKTR
RVLVLPYSNEIYDLMHTCDLAVCRSGAGTLAELVYCKKPAILVPLPTAAAHHQFYNAKIL
QSVGCAALVEQSPQLENELYILLDRILNAANNCILQTMQANFAKLDLPDPMQSAENIARL
LKKL

Enzyme Prediction     

No EC number prediction in MGYG000000509_00724.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	187	348	4.9e-43	0.9808917197452229

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03785	GT28_MurG	1.35e-102	4	360	1	350	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK00726	murG	9.75e-100	2	364	1	354	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
COG0707	MurG	1.91e-83	3	364	1	354	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
TIGR01133	murG	2.60e-78	3	361	1	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam04101	Glyco_tran_28_C	4.39e-34	187	349	1	161	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT50561.1	1.08e-139	1	364	1	360
ACC98800.1	2.65e-123	3	364	2	361
ADI01575.1	4.31e-59	4	309	8	320
AZO95093.1	2.14e-58	6	364	4	366
AOT68461.1	2.64e-58	4	325	2	331

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7D1I_A	9.17e-40	3	323	10	333	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
1F0K_A	4.93e-37	1	364	5	357	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
3S2U_A	6.31e-29	1	327	1	322	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2KE54	5.31e-124	3	364	2	361	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Elusimicrobium minutum (strain Pei191) OX=445932 GN=murG PE=3 SV=1
B8CWJ6	1.53e-56	4	328	2	336	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) OX=373903 GN=murG PE=3 SV=1
Q0AYQ8	2.72e-56	4	351	2	354	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) OX=335541 GN=murG PE=3 SV=1
Q24TE6	2.39e-54	4	357	2	362	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Desulfitobacterium hafniense (strain Y51) OX=138119 GN=murG PE=3 SV=1
B8FT56	2.39e-54	4	351	2	356	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Desulfitobacterium hafniense (strain DSM 10664 / DCB-2) OX=272564 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000509_00724.