CAZyme Information: MGYG000000509_00916

Basic Information

• Species: CADBRU01 sp900762815
• Lineage: Bacteria; Elusimicrobiota; Elusimicrobia; Elusimicrobiales; Elusimicrobiaceae; CADBRU01; CADBRU01 sp900762815
• CAZyme ID: MGYG000000509_00916
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
550	MGYG000000509_9|CGC1	60135.55	9.635

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000509	1316319	MAG	Fiji	Oceania

• Gene Location: Start: 35229; End: 36881 Strand: +

Full Sequence      

MIKKSFLLALFTCLSAALYAADAVRFEDLSLEEKLGQTLTVFVDVDSAEIFRPVIESGQV
GGVLIQWGNYSLAQTSALINKLQSWAAKSPHKIPLLISIDYEGGTVYTPITLGFDYLPTN
MMLTASGDETGAATIAYLAGLELKRAGVHMNFSPVLDVNSNPHNPIIGVRSFGSDPANVT
KMGLSLMNGFKAAGIVSVVKHFPGHGDTSVDSHYQVPVVNATYRQLQQIHLAPFQQAVQN
GVQGVMSSHILYPALDKKNIATFSAPILQDLLRVKMGFQGLIVTDSLDMKGATSFCTIAD
CAVRALHAGSDLVLLGRYIKPKTTVRRIYKQMSATPAARARVNQAARKIFDLKKQLGLLS
SPQEKPAPIDQAYRAALEQISDKAVTLVRDRAQLLPFAPQVQRGRKPTVCAVFFAPSRFA
DQLMSFTKPFLQKGWTIRSYNAALTPKAVDARRARECAQGSDLLVVTSLQWADKTNINQK
NIILALFKEHPRHVFISTMSPYDIPNYPQADTVLATYGLNKYVLQTAANIILGNVKPQGH
LPVALPEEEE

Enzyme Prediction     

No EC number prediction in MGYG000000509_00916.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	87	314	2.2e-59	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	1.96e-83	29	403	1	356	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	4.64e-77	30	352	1	316	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	4.64e-48	59	315	25	279	beta-hexosaminidase; Provisional
PRK15098	PRK15098	2.39e-20	29	400	45	410	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT50759.1	1.16e-272	18	545	14	538
ACC97651.1	4.07e-205	3	545	2	540
ALX49668.1	4.98e-89	25	547	51	584
ABG03599.1	1.77e-88	29	550	44	590
QTN01584.1	5.61e-88	29	547	4	533

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	4.07e-76	29	545	11	531	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
4ZM6_A	1.51e-66	28	550	6	532	Aunique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
3BMX_A	2.07e-64	15	546	27	618	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	6.64e-64	15	546	1	592	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	1.19e-63	15	546	31	622	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	1.13e-63	15	546	27	618	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	9.64e-59	54	545	58	596	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
Q0AF74	6.42e-45	36	315	12	282	Beta-hexosaminidase OS=Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57) OX=335283 GN=nagZ PE=3 SV=1
Q2Y863	3.34e-43	41	315	6	282	Beta-hexosaminidase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71) OX=323848 GN=nagZ PE=3 SV=1
Q7WUL3	5.34e-43	28	543	25	553	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000316	0.998958	0.000197	0.000177	0.000170	0.000159

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000509_00916.