CAZyme Information: MGYG000000510_00317

Basic Information

• Species: UMGS363 sp900541495
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UMGS363; UMGS363 sp900541495
• CAZyme ID: MGYG000000510_00317
• CAZy Family: CE2
• CAZyme Description: Acetylxylan esterase / glucomannan deacetylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
350	MGYG000000510_3|CGC1	39299.11	4.8728

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000510	2415256	MAG	Fiji	Oceania

• Gene Location: Start: 63463; End: 64515 Strand: -

Full Sequence      

MNSIKMSDKRISYSGRINFDDENAPVFYYAGSSASFRFKGTALTVKINAVIYWGELSLGA
VVDGKQCSVKLSAENNGRDIDVVIAEGLENTEHNVTIYKQHAANQLLTLKGIEIDGEMLD
APEKPKLKMEVYGDSVCAGEVIEAADYVGKCDPENHNSRYDNVWNSFVMQTARNIGAEIH
NICQGGIALFDGTGYFHHPDYIGLESVYDKLCYFPEGGLSQWDFSRYIPDIVVIAIGQND
KHNGRTDSDDINISDPEYRKVWKTAYIKMVRDLDKKYSSPKFVLTTTILMHDADWDNAIE
EIKNELNEMGIKAYHNLFTRNGAATPGHPRLSEHNEMAGELTEFIKNILN

Enzyme Prediction     

No EC number prediction in MGYG000000510_00317.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	128	345	2.2e-51	0.9952153110047847

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17996	CE2_N	6.95e-23	13	122	1	108	Carbohydrate esterase 2 N-terminal. This is the N-terminal beta-sheet domain with jelly roll topology found in CE2 acetyl-esterase from the bacterium Clostridium thermocellum. This enzyme displays dual activities, it catalyses the deacetylation of plant polysaccharides and also potentiates the activity of its appended cellulase catalytic module through its noncatalytic cellulose binding function. This N-terminal jelly-roll domain appears to extend the substrate/cellulose binding cleft of the catalytic domain in C.thermocellum.
cd01831	Endoglucanase_E_like	7.45e-12	128	346	1	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
cd01827	sialate_O-acetylesterase_like1	0.003	227	309	66	139	sialate O-acetylesterase_like family of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADU20683.1	8.80e-118	4	348	12	354
CCO05720.1	4.41e-117	11	348	15	350
AVM41764.1	3.62e-88	4	348	3	343
VCV21230.1	1.64e-86	4	348	3	342
CBL10431.1	3.28e-86	4	348	3	342

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WAO_A	3.82e-25	11	349	11	331	ChainA, ENDOGLUCANASE E [Acetivibrio thermocellus]
2WAB_A	9.98e-25	11	349	11	331	ChainA, ENDOGLUCANASE E [Acetivibrio thermocellus]
2WAA_A	1.01e-23	3	350	12	338	Structureof a family two carbohydrate esterase from Cellvibrio japonicus [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10477	1.84e-23	11	349	492	812	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2
B3PIB0	6.42e-23	3	350	31	357	Acetylxylan esterase / glucomannan deacetylase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=axe2C PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000510_00317.