CAZyme Information: MGYG000000510_01496

Basic Information

• Species: UMGS363 sp900541495
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UMGS363; UMGS363 sp900541495
• CAZyme ID: MGYG000000510_01496
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
342		39131.79	4.5684

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000510	2415256	MAG	Fiji	Oceania

• Gene Location: Start: 20418; End: 21446 Strand: -

Full Sequence      

MKRFISIVCAVSIAFSMTACAAKNDAAIQSEAATATSSAKAEKLTLSNPDATKEATELFD
YICSIYGKKILSGQQESTWMGSDQYEFDYIEKNTGKLPAIRGLDYMNDDFDGVNKRAKAW
HDKGGIVTICWHCGSDFSGSWNESMKTEIKDWDKALTEGTPEYETLIKGMDKGAEALKKL
QEQDIPVLWRPFHEFDGAWFWWGKGGSENFKKLWQLMYDRYTNYWELDNLIWVLGYSGNG
KDYDKWYPGDEYVDIAGADSYNDGANEKLYENTVKVVGESRPVAFHECGKIPTVDELKNS
NAKWVWFMTWHTDYITDHNEKETLKEIYNSDYVITLDELPKL

Enzyme Prediction     

No EC number prediction in MGYG000000510_01496.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	47	338	1.6e-97	0.9966996699669967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	3.75e-59	48	338	2	311	Glycosyl hydrolase family 26.
COG4124	ManB2	5.67e-18	140	289	139	296	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADU20874.1	3.61e-128	46	340	167	460
BCN30282.1	1.25e-123	42	341	2	298
AWB26443.1	2.17e-85	41	342	43	339
AJP70762.1	3.58e-83	46	339	22	318
ATC26721.1	4.77e-82	46	339	1	294

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q75_A	5.86e-64	48	339	25	327	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
3ZM8_A	1.21e-61	46	339	145	447	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6HPF_A	7.46e-52	48	339	8	310	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
6HF2_A	2.21e-51	43	330	42	330	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
3WDQ_A	3.67e-49	49	340	37	353	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	8.33e-60	46	339	174	476	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P49425	7.36e-50	46	340	146	458	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
P55298	8.81e-49	45	340	155	460	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1
P55297	1.26e-48	45	340	157	462	Mannan endo-1,4-beta-mannosidase B OS=Piromyces sp. OX=45796 GN=MANB PE=2 SV=1
Q5AWB7	4.53e-46	48	339	30	350	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000008	1.000067	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000510_01496.