CAZyme Information: MGYG000000510_01662

Basic Information

• Species: UMGS363 sp900541495
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UMGS363; UMGS363 sp900541495
• CAZyme ID: MGYG000000510_01662
• CAZy Family: GH5
• CAZyme Description: Endoglucanase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
389	MGYG000000510_42|CGC1	44537.43	4.8003

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000510	2415256	MAG	Fiji	Oceania

• Gene Location: Start: 13438; End: 14607 Strand: +

Full Sequence      

MKEVTSVFTALILTVCLAFSACAMSADIGSDSGEMRKEMTSAEFAKDMGMGINLGNTMEA
FWAADTRKCSGASVIGGNTPKNYETCWGAVPTTQECIAGMKSEGFDTVRIPVYWGNMMAE
DGKFTINESWFKRVDEIIEYARSADLYVVINVHHYDEYIIKNYSKDEAIKIMQKIWKQIA
EHYKNFSDYLIFEGHNENLGTVREGDNFTDDEKFDYVNEMNRIFVDTVRKTGGNNKNRML
IVSGYWTNIDLTTDSRFVIPKDTVSDRIMVSVHYIDNAMYWTNKIGGKEWLDYSRAQCEL
LKKAFTDKGIQVFVGECTSIYSKDRFAENAEHTDSTECLGIMYDMMNEYGFIPVLWDVNQ
NFYSRIKCEIIYESDRKLIRSLKDNAGSK

Enzyme Prediction     

No EC number prediction in MGYG000000510_01662.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	83	359	1.4e-74	0.9927536231884058

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	4.60e-47	77	361	9	271	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.41e-17	43	324	46	328	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
cd06564	GH20_DspB_LnbB-like	0.001	100	248	55	223	Glycosyl hydrolase family 20 (GH20) catalytic domain of dispersin B (DspB), lacto-N-biosidase (LnbB) and related proteins. Dispersin B is a soluble beta-N-acetylglucosamidase found in bacteria that hydrolyzes the beta-1,6-linkages of PGA (poly-beta-(1,6)-N-acetylglucosamine), a major component of the extracellular polysaccharide matrix. Lacto-N-biosidase hydrolyzes lacto-N-biose (LNB) type I oligosaccharides at the nonreducing terminus to produce lacto-N-biose as part of the GNB/LNB (galacto-N-biose/lacto-N-biose I) degradation pathway. The lacto-N-biosidase from Bifidobacterium bifidum has this GH20 domain, a carbohydrate binding module 32, and a bacterial immunoglobulin-like domain 2, as well as a YSIRK signal peptide and a G5 membrane anchor at the N and C termini, respectively. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL35246.1	2.39e-131	30	384	45	406
CBK97722.1	4.80e-131	30	384	45	406
CCO05195.1	3.04e-66	30	388	42	403
VEU81114.1	1.28e-63	37	386	30	395
CBL17363.1	1.06e-58	20	383	16	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WQY_A	1.32e-48	40	357	23	346	ChainA, Cellulase [Phocaeicola salanitronis DSM 18170]
6XRK_A	3.92e-48	38	385	21	366	GH5-4broad specificity endoglucanase from an uncultured bovine rumen ciliate [uncultured bovine rumen ciliate],6XRK_B GH5-4 broad specificity endoglucanase from an uncultured bovine rumen ciliate [uncultured bovine rumen ciliate]
6WQP_A	1.04e-45	37	316	12	288	GH5-4broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQP_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQV_A GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_C GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_D GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis]
6Q1I_A	3.32e-43	40	356	13	316	GH5-4broad specificity endoglucanase from Clostrdium longisporum [Clostridium longisporum],6Q1I_B GH5-4 broad specificity endoglucanase from Clostrdium longisporum [Clostridium longisporum]
4W85_A	8.38e-43	43	359	7	307	Crystalstructure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from ruminal metagenomic library, in complex with glucose [uncultured bacterium],4W85_B Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from ruminal metagenomic library, in complex with glucose [uncultured bacterium],4W87_A Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from metagenomic library, in complex with a xyloglucan oligosaccharide [uncultured bacterium],4W87_B Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from metagenomic library, in complex with a xyloglucan oligosaccharide [uncultured bacterium],4W89_A Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from metagenomic library, in complex with cellotriose [uncultured bacterium],4W89_B Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from metagenomic library, in complex with cellotriose [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O08342	3.27e-42	30	357	30	367	Endoglucanase A OS=Paenibacillus barcinonensis OX=198119 GN=celA PE=1 SV=1
P54937	4.93e-42	40	356	38	341	Endoglucanase A OS=Clostridium longisporum OX=1523 GN=celA PE=1 SV=1
Q12647	6.52e-41	37	316	21	295	Endoglucanase B OS=Neocallimastix patriciarum OX=4758 GN=CELB PE=2 SV=1
P28623	8.37e-39	37	357	39	337	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2
P23660	8.85e-38	32	356	19	327	Endoglucanase A OS=Ruminococcus albus OX=1264 GN=celA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000293	0.250308	0.749065	0.000115	0.000109	0.000100

TMHMM  Annotations     

start	end
7	29