CAZyme Information: MGYG000000512_01387

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium
• CAZyme ID: MGYG000000512_01387
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
158		17649.29	4.8092

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000512	1575087	MAG	Fiji	Oceania

• Gene Location: Start: 2295; End: 2771 Strand: -

Full Sequence      

MVAMVDVLERMDEQLYNEYRGIMAMLKQTIEDVHKFQDEETGMFWQVMDHPGVEGNYLET
SGTALFAYAVLKGVRLGYLPKRMAAWAEKAFYGTCDKYLSKNPDGSLQLDGICLVAGLGG
KDHRDGSLAYYFSEPVVCNDAKGVGPLVLAYTEMIARK

Enzyme Prediction     

No EC number prediction in MGYG000000512_01387.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	1	155	7.2e-44	0.4246987951807229

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.61e-30	2	154	211	353	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	5.68e-27	2	158	199	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK99741.1	4.59e-112	1	158	224	381
AXA82451.1	1.86e-111	1	158	224	381
ATP00557.1	2.14e-110	1	158	224	381
QIA43718.1	2.14e-110	1	158	224	381
AXB29657.1	6.62e-107	1	158	224	381

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	2.36e-38	1	153	206	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
2GH4_A	1.87e-18	1	154	209	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
1NC5_A	1.99e-18	1	154	219	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
3QWT_A	7.54e-08	2	107	239	338	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	9.99e-06	6	107	244	339	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0A3U6	4.88e-26	40	155	108	229	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	4.88e-26	40	155	108	229	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O34559	1.09e-17	1	154	219	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000015	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000512_01387.