CAZyme Information: MGYG000000512_01446

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium
• CAZyme ID: MGYG000000512_01446
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
517		57631.69	6.4131

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000512	1575087	MAG	Fiji	Oceania

• Gene Location: Start: 43; End: 1596 Strand: +

Full Sequence      

MKRIVEEYQTKNQRIVYKKIENKGIAANTNAAAELAAGEYLALADHDDILAPHAMYTMGK
AILQLRAQGEPDGFLYSDEALFSKSIQRPMVAHFKPDYAPDYLLCCNYICHLAVFQKALW
DEIGGERPECDGSQDHDLFLRLVEKTGGAAHVPQVLYYWRVHAGSTSGGTDAKPYVAAAA
KKALADHLARTGRTGTVEDGLFPSTYRVKWDIVGDPKVSILIPNKDHTDDLEKCLHSIWT
KTSWENFEVIVIENNSTDPATFAYYKEARQRYDGLQVVNYPQKGFNFSGINNFGRKYASG
DYLLLLNNDVEVRNADWLTELLRQCAHPGGAAICGAELFYPDETLQHAGVVTGLGGYAGH
SHKYRKAGGSGYMFRAATVQDFSAVTGACLLVKTSVWDEVGGLDEAFAVAFNDVDFCLRV
RDAGYRIAWTPYAQLTHYESKSRGGDEKDPVKARRFAAEQQRLYAVHGKANILHDPYYNP
NLTMDREDFSESNDLRGLKEGRITVQWRGDASPSQAH

Enzyme Prediction     

No EC number prediction in MGYG000000512_01446.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	216	441	3.2e-17	0.9304347826086956

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	2.43e-57	2	161	47	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	9.51e-41	220	439	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	2.53e-30	216	444	3	226	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
COG1215	BcsA	1.92e-17	204	433	39	260	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd02525	Succinoglycan_BP_ExoA	5.72e-15	217	438	1	208	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXB27819.1	0.0	1	508	117	624
CBL01588.1	0.0	1	508	117	624
AXA82332.1	0.0	1	508	117	624
CBK99650.1	0.0	1	508	117	624
ATL90529.1	0.0	4	509	120	625

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	6.90e-107	3	489	413	895	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	8.31e-74	3	488	366	837	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P36667	1.63e-07	218	438	2	220	Rhamnosyltransferase WbbL OS=Escherichia coli (strain K12) OX=83333 GN=wbbL PE=1 SV=1
P46370	1.79e-07	218	437	132	329	Uncharacterized 55.3 kDa protein in thcA 5'region OS=Rhodococcus erythropolis OX=1833 PE=4 SV=1
P9WMY2	4.00e-06	385	464	183	257	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000034	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000512_01446.