CAZyme Information: MGYG000000513_00724

Basic Information

• Species: Helicobacter_B fennelliae
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Helicobacteraceae; Helicobacter_B; Helicobacter_B fennelliae
• CAZyme ID: MGYG000000513_00724
• CAZy Family: GT11
• CAZyme Description: O-antigen biosynthesis glycosyltransferase WbnK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
184		21658.66	9.4634

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000513	1869856	MAG	Fiji	Oceania

• Gene Location: Start: 33571; End: 34125 Strand: -

Full Sequence      

MLQEIKTKNFNNKSYFNGLFQDYRYFHHIRESLLQDFTLKSPLQGNNATLKAHITSTLDS
AFLHIRRGDYLSNNNWYFVKLGSAYYNSAIRLLKSKIPKPHIFVFSDDKQWCKNHFLSYL
DNEVKDNVSFEFIQGNTQADATKEMELMRSCQNAIIANSTFSWWASYLIQNPNKIIICPS
RFFL

Enzyme Prediction     

No EC number prediction in MGYG000000513_00724.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT11	9	183	2.5e-54	0.5869565217391305

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11301	Fut1_Fut2_like	5.13e-40	4	182	79	254	Alpha-1,2-fucosyltransferase. Alpha-1,2-fucosyltransferases (Fut1, Fut2) catalyze the transfer of alpha-L-fucose to the terminal beta-D-galactose residue of glycoconjugates via an alpha-1,2-linkage, generating carbohydrate structures that exhibit H-antigenicity for blood-group carbohydrates. These structures also act as ligands for morphogenesis, the adhesion of microbes, and metastasizing cancer cells. Fut1 is responsible for producing the H antigen on red blood cells. Fut2 is expressed in epithelia of secretory tissues, and individuals termed "secretors" have at least one functional copy of the gene; they secrete H antigen which is further processed into A and/or B antigens depending on the ABO genotype. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
pfam01531	Glyco_transf_11	2.85e-17	15	168	125	265	Glycosyl transferase family 11. This family contains several fucosyl transferase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANV97779.1	1.21e-63	7	183	107	285
ANV98061.1	2.00e-60	7	183	101	280
QOQ90811.1	2.22e-54	2	182	1	177
QOQ96969.1	2.22e-54	2	182	1	177
BAM33288.1	2.22e-54	2	182	1	177

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58YV9	4.68e-18	20	183	126	286	O-antigen biosynthesis glycosyltransferase WbnK OS=Escherichia coli OX=562 GN=wbnK PE=1 SV=1
Q866C9	8.63e-12	25	168	174	318	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Lagothrix lagotricha OX=9519 GN=FUT1 PE=3 SV=1
Q866C7	1.18e-11	25	168	174	318	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Ateles belzebuth OX=9507 GN=FUT1 PE=3 SV=1
Q9TUD6	1.60e-11	25	168	174	318	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Pan troglodytes OX=9598 GN=FUT1 PE=3 SV=1
Q9TUD4	1.60e-11	25	168	174	318	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Gorilla gorilla gorilla OX=9595 GN=FUT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000513_00724.