CAZyme Information: MGYG000000513_01192

Basic Information

• Species: Helicobacter_B fennelliae
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Helicobacteraceae; Helicobacter_B; Helicobacter_B fennelliae
• CAZyme ID: MGYG000000513_01192
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
359		40010.47	9.9625

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000513	1869856	MAG	Fiji	Oceania

• Gene Location: Start: 9860; End: 10939 Strand: -

Full Sequence      

MPHFLITGGGTGGHLAIAKALAQELKKRNIQAIYVGSVSGQDRLWFEKSDVFLQSYFLQT
TGIVNKKGIAKIQALIAQIKALRQVRTIFKTHHIDIVISVGGFSAGPASIGAILWRKWLF
IHEQNAIKGKLNAILTPFAKQVFSAFAKESTPYPLKQEVLDSRRIRKELRTIMFIGGSQG
AKAINDFALQIAKELLSRDIHIIHQCGKNEEMRVREAYLVQGILDCVELFGFSQDIVSYL
KKADVCVGRAGASSVWENAAMGLLMIYIPYPFAAQNHQVYNAQYFVQKGLGSMLLQSDLT
KEHFFAILDTLTPDTIATLSSRLCQEVSQNGAEVIIDAILERWDNFKRNQSAIKPNSKQ

Enzyme Prediction     

No EC number prediction in MGYG000000513_01192.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	171	315	2.5e-43	0.89171974522293

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	4.52e-114	1	341	1	353	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
TIGR01133	murG	1.39e-92	4	339	3	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
cd03785	GT28_MurG	5.54e-92	3	311	1	321	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	1.29e-87	5	341	4	353	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
pfam04101	Glyco_tran_28_C	6.16e-39	171	335	1	166	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAP77524.1	2.49e-122	4	339	2	344
BAM11520.1	3.65e-122	4	339	2	342
BBB19037.1	3.65e-122	4	339	2	342
BAM31450.1	7.34e-122	4	339	2	342
QOQ90380.1	7.34e-122	4	339	2	342

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7D1I_A	1.63e-38	3	339	11	362	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
3S2U_A	4.51e-32	5	341	6	353	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
1F0K_A	2.14e-29	5	322	10	333	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7U322	4.98e-123	4	339	2	344	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) OX=235279 GN=murG PE=3 SV=1
A0RP87	1.04e-108	6	342	4	335	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Campylobacter fetus subsp. fetus (strain 82-40) OX=360106 GN=murG PE=3 SV=1
B5Z8F1	2.27e-104	4	340	3	351	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Helicobacter pylori (strain G27) OX=563041 GN=murG PE=3 SV=1
Q9ZK59	6.44e-104	4	340	3	351	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Helicobacter pylori (strain J99 / ATCC 700824) OX=85963 GN=murG PE=3 SV=1
O25770	3.66e-103	4	340	3	351	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Helicobacter pylori (strain ATCC 700392 / 26695) OX=85962 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000513_01192.