CAZyme Information: MGYG000000514_00329

Basic Information

• Species: CAG-590 sp900769115
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-590; CAG-590 sp900769115
• CAZyme ID: MGYG000000514_00329
• CAZy Family: GT0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
407	MGYG000000514_4|CGC1	46754.59	5.2263

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000514	3147233	MAG	Fiji	Oceania

• Gene Location: Start: 15337; End: 16560 Strand: -

Full Sequence      

MKHFINLLRRAFGILRTKGIKGAAAIVKEMDTQMDIPAFYDYIMDDVAIPFVDGEKQQLL
SEKNTIINWVIPEMGIGSGGHINIFRFVQKLQDMGIKNRVYIFRCGALDTDKAFKDFIDQ
YYDLDTEHIELYHSVDNMKPAHAIIATSWQTAYFVRKFDKCISKFYFVQDFEPYFYAVGS
EYTFAENTYKFGLRGITAGDWLKDKLRDEYGMKTESFSFSYDKELYKAIEKRDDKKRLFF
YARPVTPRRAFELGLLALTEVAKRLPDVEVIFAGWDVGGYKIPFTHLNAGSVRLEELADL
YSQCDMCLVLSNTNLSLLPLEVMASNSVAVCTKGANSSWLVNETNSVMVDFDPIAIADTL
CYYLEHRDELAVIRKRGLDFALSTSWDKEAEKVYDAIMRGIEEDAKN

Enzyme Prediction     

No EC number prediction in MGYG000000514_00329.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	1.11e-18	67	397	2	365	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	1.10e-07	95	403	59	380	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03809	GT4_MtfB-like	2.20e-05	196	393	143	360	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.
cd03794	GT4_WbuB-like	2.48e-05	141	393	104	390	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
cd03825	GT4_WcaC-like	2.73e-04	196	397	142	364	putative colanic acid biosynthesis glycosyl transferase WcaC and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Escherichia coli WcaC has been predicted to function in colanic acid biosynthesis. WcfI in Bacteroides fragilis has been shown to be involved in the capsular polysaccharide biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYX25932.1	1.19e-164	1	404	1	404
AMK55186.1	1.82e-163	8	406	5	402
BBP72133.1	8.97e-113	6	398	8	402
CCI71311.1	5.79e-112	4	402	5	409
ABM68323.1	4.39e-107	1	403	8	413

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2X0D_A	5.70e-10	46	368	28	384	APOstructure of WsaF [Geobacillus stearothermophilus],2X0D_B APO structure of WsaF [Geobacillus stearothermophilus]
2X0E_A	7.59e-10	46	368	28	384	Complexstructure of WsaF with dTDP [Geobacillus stearothermophilus],2X0E_B Complex structure of WsaF with dTDP [Geobacillus stearothermophilus],2X0F_A Structure of WsaF in complex with dTDP-beta-L-Rha [Geobacillus stearothermophilus],2X0F_B Structure of WsaF in complex with dTDP-beta-L-Rha [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q50864	2.88e-25	145	398	995	1254	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000028	0.000007	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000514_00329.