CAZyme Information: MGYG000000514_02651

Basic Information

• Species: CAG-590 sp900769115
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-590; CAG-590 sp900769115
• CAZyme ID: MGYG000000514_02651
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
355		40185.88	7.3968

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000514	3147233	MAG	Fiji	Oceania

• Gene Location: Start: 3821; End: 4888 Strand: -

Full Sequence      

MKELIPIVIPAYEPDERLIMLLEELKKNDMKPVIVVDDGSGEQYADVFLQAEKLVTEYGG
TLLKHTVNCGKGRALKTGFSYILQHMPAAIGCVTADSDGQHTVSCIERVQQALQNNPMNL
ILGVRDFDNENIPWKSQFGNTVTEKVFAYVAGIHVTDTQTGLRGIPRAFMESLLQVKGER
FEFETQMLLESRKQFPIKEVKIETIYESKDNHQTHFRPLVDSWKIYRILGKQFFCFIISS
LSSSVIDIALFALFCMLFKQRIPEAYVAVSTAIARIISATYNYIINYKIVFDSRKQHSIS
VGKYILLAVCQMALSAGLVTGGTLLLSFVPEVIIKIIIDTALFFVSYHIQQRYVF

Enzyme Prediction     

No EC number prediction in MGYG000000514_02651.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04179	DPM_DPG-synthase_like	5.42e-32	7	189	1	183	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.
cd04188	DPG_synthase	5.12e-17	7	203	1	203	DPG_synthase is involved in protein N-linked glycosylation. UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate.
PTZ00260	PTZ00260	2.88e-12	7	200	74	284	dolichyl-phosphate beta-glucosyltransferase; Provisional
COG0463	WcaA	9.25e-12	1	289	1	280	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam00535	Glycos_transf_2	6.45e-10	7	147	2	137	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWT52085.1	3.33e-148	2	355	3	356
ADL33213.1	3.73e-90	5	355	3	374
AEA00670.1	6.21e-88	5	355	6	358
AMB95301.1	1.24e-87	5	355	6	358
ALC82592.1	3.41e-87	5	355	7	347

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58619	6.41e-21	2	206	16	216	Uncharacterized protein MJ1222 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1222 PE=4 SV=1
B3VA58	2.38e-15	3	206	4	220	UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminyltransferase OS=Methanococcus voltae OX=2188 GN=aglK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000089	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
233	255
265	287
299	321
325	347