CAZyme Information: MGYG000000515_00198

Basic Information

• Species: UBA2882 sp900549665
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA2882; UBA2882 sp900549665
• CAZyme ID: MGYG000000515_00198
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
721	MGYG000000515_1|CGC4	83540.69	6.1178

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000515	2818145	MAG	Fiji	Oceania

• Gene Location: Start: 240457; End: 242622 Strand: -

Full Sequence      

MSNPIKKKILEYQLNKCHKKYKKKLAMLSDPYGMWISTMEDRTAGNARVTAIKVCDFISL
LVNGGDCGPDVDTEAWIAVPLTDGKYEMPSGSYDVIFSSQSEYGMAYSDEDMIDFGQNKR
YGAWMKPSESPDTLLSFFYYGSMLFISGMHLLKYLGTDHANHNIAQWLADLKMSMTTDKK
QDDMDNRDIDRICERNVIYDFTLRYSEYLSENGLKIKHIPQVLFHGYGTKWEPENPKKPE
VVNENAYWGYEPVYDGIKLDAMKRRKIRGKMEEHDFAGRIYSCPVYMSQKEDGTLPLVSI
VIPSKDNVLVLKKCLYSLKEKTLYPKYEIILVDNGSCEENRLEILRLQRELGFKYIYEKM
DFNFSKMCNIGAGKASGDYILLLNDDMEIVQPDWLDIMVGQASISYIGAVGAKLLYPDSD
VIQHVGITNLRVGPAHKLLKEHDSVDYYYGRNVLPYDMIGVTAACLLVGRKKYWQVGGFC
EDIAVAYNDVDFCFSLYDNGYYNVIRNDVVLYHHESISRGDDALDEEKWDRLLKEKDFCY
SRHLSLKGKDPFYNPNLAGFKHKYFCGYLYPYEQRLSFSSVEIFSKDILPEWHNNCLMVT
LEHVRLERKLDLEDERDVYWLEGWAYVLGMDSARYKKKIILINADETKKKFVIQPFDRYR
QDVVDILPDQVNVALSGFSCRIKREDLQEGKYKIAVLFEDTCSRQKLYKECGTGLTVEKR
A

Enzyme Prediction     

No EC number prediction in MGYG000000515_00198.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	299	476	3.7e-18	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	6.37e-29	300	515	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	2.12e-15	299	473	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG1216	GT2	3.13e-15	296	521	3	227	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd00761	Glyco_tranf_GTA_type	3.24e-13	300	399	1	99	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd04184	GT2_RfbC_Mx_like	3.00e-10	93	225	102	199	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUF73846.1	7.98e-119	89	708	796	1352
ABR36854.1	7.98e-119	89	708	796	1352
AIU02421.1	7.98e-119	89	708	796	1352
AVK48684.1	2.13e-118	89	708	796	1352
CBK92935.1	1.55e-109	89	706	155	704

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	4.18e-42	292	558	622	889	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	3.23e-34	97	558	426	832	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000515_00198.