CAZyme Information: MGYG000000515_00290

Basic Information

• Species: UBA2882 sp900549665
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA2882; UBA2882 sp900549665
• CAZyme ID: MGYG000000515_00290
• CAZy Family: GT2
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
948		108136.07	5.321

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000515	2818145	MAG	Fiji	Oceania

• Gene Location: Start: 359251; End: 362097 Strand: -

Full Sequence      

MEQKVSVIVPIYKVEPYLKRAVASILHQTYHNLEIILVDDGSPDQCGRICDDYAKEDNRI
TVIHKENGGLSDARNAGLDAAHGEYIVFVDSDDFIAEDYVETLMQCLKKYDADVAMCSYA
VTASVELDESIFKASRDETVEVCDRRELLNNLYDANHKDATYFIVSWNKIYKASLWQDVR
FPRGRIHEDEATTYKIYDRAQKGVYLHRPLYGYFTAPSSITRDRFNIKRLQWMDALDDRI
AYFEDKKDSLLKDEQNRSCLQNRESDSKEEQPVEDAGQKEAAQLNEEGKRETEFLEKQIA
CCKRARADASIHYYYPLKEELPTERKAAKRLKSYVWQEWKETKNPGYLIFSVSASLYRLI
TNIDRDKKERIFQLLCVCLFAWLAFLCFYKLDVKYVDPWDEARHGVNAYEMLKQGSLVKS
TYLYQTDYYNLKPPLSMWSIMLSMVLFGKSVWTLRLASVICYLCLALCVVCFARKSYGRL
PALFSLALLCSNTTPFIAHMVRAGDADSLYVLLFSLAMICMLQIRDDHRKLYLCGFLFAL
AFLTKSFHAGLIAVIGGLYLLLTGLFKKIRLKEYVFFILSFGAPIGFWVIARLCTDGTAF
LKEMWLTDVLGRSRSGFGSNEAGFSYYFSYYLGNMSGKVPVYRVVLCLLLVSCLILAVMS
FVQKHKTKHGADDNGTKSVKDDMIGFSLWILIPALAFSVVRTKLLWYEYPAITALLIVAG
IAAGLVCEKKMLPVGIRVALGAVLLVTAGYYSHDLLQTFEQYGKDGYMTNDFQLLIEETA
NGAQMYGTEIKESAKKADETRANKEIEKTGKQGVTVYAYRALTTEDPEKPVDTQWAQQDV
YVAEAYGDYICENDGWDHMLEDMKDGSEEDCRILFTTQELLEQYREGLADVSSDDAQKTT
MVEGNADDWESRAENAGADVSENMQIIMNVLCQRGDYVSVQCQLQPIK

Enzyme Prediction     

No EC number prediction in MGYG000000515_00290.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	373	751	5.5e-54	0.6444444444444445
GT2	6	122	1.1e-36	0.6941176470588235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00535	Glycos_transf_2	3.86e-36	6	118	1	114	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
PRK10073	PRK10073	6.33e-36	4	241	7	254	putative glycosyl transferase; Provisional
cd00761	Glyco_tranf_GTA_type	7.85e-35	7	153	1	151	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
COG0463	WcaA	3.77e-25	1	245	1	227	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
COG1807	ArnT	9.94e-25	367	749	6	363	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO23347.1	2.61e-66	5	244	6	241
QES75627.1	3.98e-65	5	244	8	241
AVK48560.1	5.49e-65	5	244	8	241
QUN34788.1	5.49e-65	5	244	8	241
QJX64180.1	1.37e-63	1	265	1	274

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	7.46e-45	5	224	7	226	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
3BCV_A	7.11e-30	4	113	6	115	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
5TZE_C	1.45e-14	4	215	2	204	Crystalstructure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZE_E Crystal structure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZI_C Crystal structure of S. aureus TarS 1-349 [Staphylococcus aureus],5TZJ_A Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZJ_C Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZK_C Crystal structure of S. aureus TarS 1-349 in complex with UDP [Staphylococcus aureus]
5TZ8_A	3.82e-14	4	215	2	204	Crystalstructure of S. aureus TarS [Staphylococcus aureus],5TZ8_B Crystal structure of S. aureus TarS [Staphylococcus aureus],5TZ8_C Crystal structure of S. aureus TarS [Staphylococcus aureus]
2Z87_A	3.84e-13	5	131	376	500	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli],2Z87_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0H2URH7	1.09e-43	1	241	3	239	Glycosyltransferase GlyA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyA PE=3 SV=1
A0A0H2UR96	4.75e-42	1	227	1	228	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1
P71059	2.51e-32	5	221	5	219	Uncharacterized glycosyltransferase EpsJ OS=Bacillus subtilis (strain 168) OX=224308 GN=epsJ PE=2 SV=1
P71057	3.17e-30	5	222	6	220	Putative glycosyltransferase EpsH OS=Bacillus subtilis (strain 168) OX=224308 GN=epsH PE=2 SV=1
Q57022	1.76e-19	5	176	6	192	Uncharacterized glycosyltransferase HI_0868 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0868 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
371	389
451	473
508	525
540	562
574	591
640	662
683	700
705	727
734	751