CAZyme Information: MGYG000000515_01703

Basic Information

• Species: UBA2882 sp900549665
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA2882; UBA2882 sp900549665
• CAZyme ID: MGYG000000515_01703
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
693		76004.47	4.3472

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000515	2818145	MAG	Fiji	Oceania

• Gene Location: Start: 39079; End: 41160 Strand: +

Full Sequence      

MNKRCKHQLERILYISVALLLVLGLGFLCVWGFSTIQKYRRQQALENGSYSPDGQETVSE
AGVEEETVSVEENLSQNGTGVTEEQEEPVDTVLLSAQQMIADMTLEEKVYQLFIVTPDAL
TGANPAVAAGEQTRKSLTDYPVGGLVYFAKNLTDKEQTKTMLANTQSYALETQELPLLLC
VDEEGGKVTRIASNSSFGVDNVGDMQDITQVDEAYKAGEYIGSYLQDLGFNLDFAPDTDV
RTNDADVAIGKRSFGSDPQQVSELAKAYSDGLHEHGVMSTFKHFPGHGAVAQDTHDGFAY
TQKGYDELMQSEWVPFQKAGDYGIDVVMVGHISLPSVTGDDTPASLSEKMVREILRTDLG
YDGLIVTDALNMGAITQKYSSSEACVRAFTAGADLLLMPADFHEAADGMMRAVQDGSISE
DRLDESLLRIVHAKLLWQQESGMYRQETDNNKANSDKVNSNKANSDRSNRDKAGNVNNNK
ENDGKSEQNVNYTPMIDVSAYQGNVDWTKVADGGIKGAMIRLGFRGYGAEGSLNTDKNFS
KNLKGAKAAGLKTGVYFHSEAQNISEAEEEALYVLGILKNETLELPVAYDLEYNNSVDKR
SNALNTAERTELAQAFCKKIQEAGYEPMVYYDVAALREKTLDLSALSGIKVWVADYEHEV
EPAYAGGYQMWQYSNCGSVSGIKGAVDLNHYID

Enzyme Prediction     

No EC number prediction in MGYG000000515_01703.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	173	398	6.6e-51	0.9675925925925926
GH25	496	682	1.7e-41	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00933	Glyco_hydro_3	1.90e-77	104	430	1	313	Glycosyl hydrolase family 3 N terminal domain.
COG1472	BglX	2.30e-69	103	434	1	312	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
cd06414	GH25_LytC-like	9.21e-64	496	692	4	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
PRK05337	PRK05337	1.63e-49	142	398	26	279	beta-hexosaminidase; Provisional
cd00599	GH25_muramidase	2.71e-32	495	689	2	184	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL10373.1	5.85e-120	50	438	42	430
CBL12317.1	2.31e-119	50	438	42	430
VCV21172.1	3.26e-119	50	438	42	430
AEN97392.1	1.28e-116	82	435	75	429
QJU21548.1	1.61e-111	77	435	67	440

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	1.65e-62	103	434	11	337	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	4.57e-55	94	452	33	408	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	1.47e-54	94	452	7	382	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	2.44e-54	94	452	37	412	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
4YYF_A	7.74e-41	127	429	53	354	ChainA, Beta-N-acetylhexosaminidase [Mycolicibacterium smegmatis MC2 155],4YYF_B Chain B, Beta-N-acetylhexosaminidase [Mycolicibacterium smegmatis MC2 155],4YYF_C Chain C, Beta-N-acetylhexosaminidase [Mycolicibacterium smegmatis MC2 155]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	2.50e-54	94	452	33	408	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	1.73e-39	137	441	59	387	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
L7N6B0	2.97e-38	175	434	116	380	Beta-hexosaminidase LpqI OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=lpqI PE=1 SV=1
A0A0H3M1P5	7.55e-38	175	434	116	380	Beta-hexosaminidase LpqI OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) OX=410289 GN=lpqI PE=3 SV=1
Q5QUZ5	8.12e-36	132	398	16	276	Beta-hexosaminidase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) OX=283942 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000002	0.000000	0.000000	0.000000	0.000001

TMHMM  Annotations     

start	end
12	34