CAZyme Information: MGYG000000516_01476

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UMGS902
• CAZyme ID: MGYG000000516_01476
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
410		44653.1	8.2496

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000516	1853543	MAG	Fiji	Oceania

• Gene Location: Start: 802; End: 2034 Strand: -

Full Sequence      

MLDTLILILTLLLKAASLWFLAVALFALRKPKSYAVCAPRTRFACLVAARNEEAVIGALV
ESLKKQDYPDALYDIFVIPNNCTDDTESEALCAGAKIFRCFEPVRCKGDALHEAVAWLLP
QRYDAFCVFDADNVADERFLARMNDAFCAGAQVCKGAMRAKNPYDSWLSGCYGLYFTLFD
TFFSRARMSCGLSSKLVGTGFAVHRAVLERFGGWNTSTIAEDAEFAAQCAANGVRVCFVP
GALTYDEAPNDFAVSLRQRRRWCSGIMDVAVRMDAPLVSALRGSAPLRALDALLIVNAPF
LQALTLLPLTLTILSSLVQGTAGTLALTGAVSLTLSTLGLMALAALLAYLGGYRDRRIVR
TVAGFPLFMAAWLPLQLVSLVSRTRSWQPIAHTRAVRAESLRDAGFLTTI

Enzyme Prediction     

No EC number prediction in MGYG000000516_01476.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	39	263	2.5e-29	0.9869565217391304

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06438	EpsO_like	5.67e-56	46	225	2	183	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
COG1215	BcsA	1.31e-34	46	272	59	290	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	6.26e-34	46	222	2	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
pfam13641	Glyco_tranf_2_3	4.26e-23	42	262	3	227	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
pfam13632	Glyco_trans_2_3	7.68e-21	130	296	6	173	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMJ39935.1	1.24e-119	13	392	15	398
ALU13522.1	3.13e-78	15	402	18	411
QCT71577.1	3.13e-78	15	402	18	411
ADO38773.1	4.41e-78	15	402	18	411
ARD65366.1	4.41e-78	15	402	18	411

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	1.14e-17	46	275	54	289	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
P74165	2.20e-14	39	265	106	335	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1
Q8YMK0	2.15e-13	46	265	111	333	Beta-monoglucosyldiacylglycerol synthase OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=all4933 PE=1 SV=1
Q3MB01	9.08e-13	46	265	111	333	Beta-monoglucosyldiacylglycerol synthase OS=Trichormus variabilis (strain ATCC 29413 / PCC 7937) OX=240292 GN=Ava_2217 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000082	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
5	27
292	314
329	351
358	380