CAZyme Information: MGYG000000517_00378

Basic Information

• Species: UMGS1889 sp900556055
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UMGS1889; UMGS1889 sp900556055
• CAZyme ID: MGYG000000517_00378
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
592	MGYG000000517_2|CGC5	68107.89	5.2324

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000517	2612851	MAG	Fiji	Oceania

• Gene Location: Start: 142340; End: 144118 Strand: +

Full Sequence      

MPKNINARNSHLLPGLFKERSDVNRAYLMELKTENLVQNFLLEAGVRTDRDITEMHLGWE
SPTCQLRGHFLGHWLSAASLLIAENGDRELKAKLDNIIDELERCQKLNGGRWIGSIPEKY
FEKLEKNEYIWSPQYTLHKTLLGLYHSAMYAGSDKALTILSNAADWYTDWTEDMAKKNPH
VVYSGEEGGMLEVWAGLYQLTGDKRYFTLAERYSHPSIFKKLADDGDPLSDCHANASIPW
AHGAAKMYEITGDEKWLDLVKRFWKCAVLDREAFCTGGQNSGEFWIPPHKLGMYIGDRTQ
EFCTVYNMVRLADYLFCFTGESSYLDYIEKNLYNGFLAQQNKFTGMPAYFLPMKSGSAKK
WGSKTKDFWCCHGTTVQAHTIYPQLCWYEDGERLIAAQYINSEYRRSDNVTVTQSVDMKY
YNDGASFDEHDDSRMSRWYIRLNVRAEKPEKFTLSLRIPEWVKGEPAVYVNGEEMKISAS
NGFADIERTWENDTINVYFPAALTMSSLPDMPKLTAFSEGPIVLAGLCEKDCGIYVENND
PESALAGTIEHTYSTFPWQQSVYRTINQPENFEFVPIYDITDEKYTVYFTKK

Enzyme Prediction     

No EC number prediction in MGYG000000517_00378.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	12	525	5.9e-162	0.9920477137176938

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	2.73e-112	9	525	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	2.14e-72	6	531	8	507	Uncharacterized conserved protein, DUF1680 family [Function unknown].
COG1331	YyaL	2.48e-05	176	332	399	564	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].
pfam03663	Glyco_hydro_76	0.006	242	278	226	259	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
cd04791	LanC_SerThrkinase	0.008	154	262	63	170	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL17727.1	0.0	1	592	1	594
ADL50077.1	2.01e-264	1	591	1	602
ADU23130.1	4.10e-231	1	592	1	602
QUA54004.1	8.84e-231	5	590	5	601
QTE68365.1	1.85e-227	12	590	12	600

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	1.38e-65	12	589	35	648	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	3.05e-62	12	589	35	648	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
3WRE_A	1.73e-09	74	483	81	519	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	1.74e-09	74	483	81	519	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]
7EXU_A	4.00e-09	74	483	81	519	ChainA, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	9.45e-09	74	483	81	519	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000517_00378.