CAZyme Information: MGYG000000517_01121

Basic Information

• Species: UMGS1889 sp900556055
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UMGS1889; UMGS1889 sp900556055
• CAZyme ID: MGYG000000517_01121
• CAZy Family: GH5
• CAZyme Description: Endoglucanase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388		42859.19	4.4269

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000517	2612851	MAG	Fiji	Oceania

• Gene Location: Start: 120892; End: 122058 Strand: -

Full Sequence      

MNFKKLLGFAAATAMSLTMLGGCGKTTTDADSGNAEETTAASEPAEVLTASELVKGMKIG
WSLGNTLDAQQLKWTKVDDPIQFETSWGNVQTTQQIIDTVKSAGFNVIRIPITWESHVGD
APDYKINEKWMARVKEVVDYAYGDGTYVIINLHHEEWHFPSEENYPAASEKLKAMWIQIA
AEFQDYDQHLIFEGLNEPRMKGTGQEWTGGTPEAREVINKLNADFVATIRAQSGNNPDRC
LMIPTIAASGDAPALSGFTVPNDDKVIVSIHAYKPYNFALNITGTAEFNVDADKGEIDTI
MNNIKTNFLDKGIPVVIGEYGMMNKNNTEARAAALDYYLSAAKELGVPCVWWDNGAFDGN
GENFGILDRSTCTWKYPELMDVFKKYAE

Enzyme Prediction     

EC	3.2.1.4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	84	355	1.4e-101	0.9891304347826086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	3.90e-77	81	358	13	272	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.04e-45	51	376	45	382	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
COG3867	GanB	0.006	50	243	36	220	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL17440.1	4.32e-145	2	388	5	377
CBK96050.1	1.54e-132	2	381	3	391
ADK66823.1	6.75e-129	31	388	10	367
CCO06082.1	1.58e-126	1	385	1	380
CBL35038.1	2.12e-126	19	381	7	376

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WQP_A	2.39e-122	48	385	14	354	GH5-4broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQP_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQV_A GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_C GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_D GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis]
3AYR_A	1.21e-117	48	385	18	358	GH5endoglucanase EglA from a ruminal fungus [Piromyces rhizinflatus]
3AYS_A	9.81e-117	48	385	18	358	GH5endoglucanase from a ruminal fungus in complex with cellotriose [Piromyces rhizinflatus]
6Q1I_A	2.99e-116	43	381	7	347	GH5-4broad specificity endoglucanase from Clostrdium longisporum [Clostridium longisporum],6Q1I_B GH5-4 broad specificity endoglucanase from Clostrdium longisporum [Clostridium longisporum]
6PZ7_A	5.67e-111	48	380	7	330	GH5-4broad specificity endoglucanase from Clostridium acetobutylicum [Clostridium acetobutylicum ATCC 824]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q12647	4.03e-118	48	381	23	357	Endoglucanase B OS=Neocallimastix patriciarum OX=4758 GN=CELB PE=2 SV=1
P23661	1.71e-117	1	388	1	401	Endoglucanase B OS=Ruminococcus albus OX=1264 GN=celB PE=3 SV=1
P23660	2.55e-116	48	388	25	364	Endoglucanase A OS=Ruminococcus albus OX=1264 GN=celA PE=1 SV=1
P54937	3.17e-114	43	381	32	372	Endoglucanase A OS=Clostridium longisporum OX=1523 GN=celA PE=1 SV=1
P16216	4.83e-111	1	388	1	399	Endoglucanase 1 OS=Ruminococcus albus OX=1264 GN=Eg I PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000055	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000517_01121.