CAZyme Information: MGYG000000520_01292

Basic Information

• Species: Firm-07 sp900548735
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; Firm-07; Firm-07 sp900548735
• CAZyme ID: MGYG000000520_01292
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
425		48832.92	9.4351

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000520	1867000	MAG	Fiji	Oceania

• Gene Location: Start: 1680; End: 2957 Strand: -

Full Sequence      

MQLFDFLLGVYIVCMAICLMLYLPRLRCWLYARYRQPRLVAKTKRNLAVIIPARNESAAI
TPLLESLDRQTYPKEHFGVHVIVKEPDDPTIAIAGKAGARVHVVRGQKRKGDALDACLKD
ILTNEPTRYDNYIIVDADCILDEKFLEEMNNAAESGAEIITSKKKVKNYFYGNRETQPLS
ACCNGIIWTLMDNMGNAAKSKSGLPCFVVGTGLMLRADIVRQNGGWPYRATVTEDVELQQ
DTVLQGWKTFYYQYAVLYMEEATNHRVTNKRRRRWMTGVIDSKRLYAPKIAADAKARHRR
REIYHTRNLWIVYLFVGLATLFFAANAVTAILLSTFRVPEWFYAARNAAIGFLTVYLMFF
IMTAVALFADWENIRIPFYRKIELLFVHPLFYMEYIPIVGVALFTGFGRTWDAIDRVSFA
ENEGK

Enzyme Prediction     

No EC number prediction in MGYG000000520_01292.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	46	277	1.7e-20	0.9826086956521739

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06438	EpsO_like	2.76e-32	49	238	1	183	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
COG1215	BcsA	8.14e-25	6	399	20	401	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	5.83e-20	49	235	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
pfam13641	Glyco_tranf_2_3	2.00e-15	45	278	2	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd04192	GT_2_like_e	1.44e-12	49	278	1	229	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE15924.1	1.90e-111	21	417	17	413
QNL97367.1	2.53e-77	17	425	19	448
BCI61275.1	3.00e-40	42	404	43	403
QNM07486.1	7.88e-40	46	403	46	397
AUO18464.1	7.31e-38	41	404	39	394

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000082	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
4	26
310	332
347	369
382	404