CAZyme Information: MGYG000000522_01409

Basic Information

• Species: Methanobrevibacter_A sp900766745
• Lineage: Archaea; Methanobacteriota; Methanobacteria; Methanobacteriales; Methanobacteriaceae; Methanobrevibacter_A; Methanobrevibacter_A sp900766745
• CAZyme ID: MGYG000000522_01409
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
639		73709.33	9.609

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000522	1691878	MAG	Fiji	Oceania

• Gene Location: Start: 4950; End: 6869 Strand: +

Full Sequence      

MILSIIIPTYNEEEYLPVLLDSIKEQSFKDYEIIVADANSTDRTREIAEEYGCIVVDGGM
PAVGRNRGAEVAKGEILLFLDSDLKLTDEYLNDLIYEFRMERLGIGITQMTPLSEKTQDK
ILHEFANIFMMSVESIKPHGAGCYGIVVKKNLHDEFDGFDEDLTFGEDTDYIERIAKKER
FKVLRKPKIGVSTRRLEEEGLLTLVRQYGKSTLNDFMGKRTDAESLNYDFGHENPVSAPR
TRLDEIAIDSEKIEKIKKNLRKVETPIKDTKKKIKNAQSPLKLKIPKGRDKKIVFYTVCG
EGMGHAIRSKVIIDAIKDKYDVYIFSSDRSYKYLKDKLPNVYKIGGFNTVYQNNKVNNKK
TFYNAIKDNPHNLKEGYEILYKKAKELKPNIIVTDFEIYGSIVSKLLNIPLISLDNINII
TQAKIDYPPKHKVSMLKAKAVIKGYVIKPKIHILTSFFYPKIKSNKRAVIYPPVLREGIL
KIKPETHDHIVVYQTSAENIKLVKHLKRLDEKFIVYGFNKEKTEDNLHFKRFSEEQIYKD
LSNAKAVIANGGFTFISESLYLKKPTFSIPANGNFEQLLNGFYVEKLGFGQYDEKINMPK
IKEFLNNLPQYQDRLKQIKKTNNKGIVNELIYRIEKYSE

Enzyme Prediction     

No EC number prediction in MGYG000000522_01409.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	4	101	8.1e-25	0.6235294117647059

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13528	Glyco_trans_1_3	1.12e-85	294	609	3	321	Glycosyl transferase family 1.
TIGR00661	MJ1255	4.86e-73	294	612	2	316	conserved hypothetical protein. This model represents nearly the full length of MJ1255 from Methanococcus jannaschii and of an unpublished protein from Vibrio cholerae, as well as the C-terminal half of a protein from Methanobacterium thermoautotrophicum. A small region (~50 amino acids) within the domain appears related to a family of sugar transferases. [Hypothetical proteins, Conserved]
cd02522	GT_2_like_a	5.00e-33	3	202	1	195	GT_2_like_a represents a glycosyltransferase family-2 subfamily with unknown function. Glycosyltransferase family 2 (GT-2) subfamily of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
TIGR04283	glyco_like_mftF	9.50e-31	3	202	1	194	transferase 2, rSAM/selenodomain-associated. This enzyme may transfer a nucleotide, or it sugar moiety, as part of a biosynthetic pathway. Other proposed members of the pathway include another transferase (TIGR04282), a phosphoesterase, and a radical SAM enzyme (TIGR04167) whose C-terminal domain (pfam12345) frequently contains a selenocysteine. [Unknown function, Enzymes of unknown specificity]
cd00761	Glyco_tranf_GTA_type	1.41e-26	5	108	1	112	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ59264.1	0.0	1	639	1	632
ABQ86628.1	1.60e-317	1	639	1	632
AMD17039.1	3.73e-309	1	638	1	630
ALT68389.1	1.48e-306	1	639	1	632
AMK14917.1	1.28e-267	1	638	1	641

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5TZE_C	4.64e-11	4	93	4	103	Crystalstructure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZE_E Crystal structure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZI_C Crystal structure of S. aureus TarS 1-349 [Staphylococcus aureus],5TZJ_A Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZJ_C Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZK_C Crystal structure of S. aureus TarS 1-349 in complex with UDP [Staphylococcus aureus]
5TZ8_A	8.45e-11	4	93	4	103	Crystalstructure of S. aureus TarS [Staphylococcus aureus],5TZ8_B Crystal structure of S. aureus TarS [Staphylococcus aureus],5TZ8_C Crystal structure of S. aureus TarS [Staphylococcus aureus]
5HEA_A	8.61e-11	2	118	6	129	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0H3JPC6	4.64e-10	4	93	5	104	Poly(ribitol-phosphate) beta-N-acetylglucosaminyltransferase TarS OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=tarS PE=1 SV=1
A0A0H3JVA1	4.64e-10	4	93	5	104	Poly(ribitol-phosphate) beta-N-acetylglucosaminyltransferase TarS OS=Staphylococcus aureus (strain MW2) OX=196620 GN=tarS PE=1 SV=1
Q4L977	2.58e-09	3	112	43	160	4,4'-diaponeurosporenoate glycosyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) OX=279808 GN=crtQ PE=3 SV=1
O32268	3.10e-09	2	150	7	163	Putative teichuronic acid biosynthesis glycosyltransferase TuaG OS=Bacillus subtilis (strain 168) OX=224308 GN=tuaG PE=2 SV=1
E0U4V7	1.05e-08	1	91	1	102	Poly(ribitol-phosphate) beta-glucosyltransferase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000522_01409.