CAZyme Information: MGYG000000524_00965

Basic Information

• Species: UBA4636 sp900770945
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UBA4636; UBA4636 sp900770945
• CAZyme ID: MGYG000000524_00965
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
655	MGYG000000524_8|CGC1	74627.43	7.1354

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000524	2043068	MAG	Fiji	Oceania

• Gene Location: Start: 39617; End: 41584 Strand: -

Full Sequence      

MSIKKAKQVKKDEKQAEKTVKAVEKATEKAVEEVKEEVKKAKNSEAAAVKKEEKKIEKAA
EVKVKTEEKVQKKEAAKKEEATVVLAPEKQKKTVEKTDEKQKKAAEKVAKKVQKKLEKTD
KEEVKLEEKAVEKAEKENEKIEEKLAEKQLKEEEAEKIVPEENKEQAESQQKDIEVEVVR
KRSLLFVASECNPFVGTGGLADVIGSLPLAISERGNYDVRVILPLYGTMDEGYRNHLTYI
GNFNVPVGWRNQYCGLFSYKRKGVTYLFIDNEYYFRRPTLYGHYDDGERFAFFSRAVLEA
MQYMNWYPDVMHCHDWQTALAVIYLKTIYANRWGFDHIRAIFTIHNIEYQGKYGKEILED
LFGLPYDVEPALDYDGCLNLMKGAIQLSDYVTTVSKTYAEEIKNEYFAHGLQYAINDNAG
KIIGILNGISEEVYNPETDKALFKNYSVSDMSGKAVCKAELQKMLGLPERADVPVIAIIS
RLVAHKGLDLVKCILEELLAENVQVVILGKGEAYYEGYFGYIADNYRGKCKTIIAYNKDL
SSKIYSGADIFLMPSKQEPCGLSQMIACRYGTVPVVRRTGGLNDSITAYNTDRKGGNGFA
FSNYNAHEMLYVLKDAIYTYGNKEEWNKIVKCAMTTDFSWKKSAAEYEKLYDLFK

Enzyme Prediction     

No EC number prediction in MGYG000000524_00965.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	185	651	3.3e-176	0.989406779661017

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02095	glgA	0.0	185	651	4	470	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG0297	GlgA	0.0	184	651	3	475	Glycogen synthase [Carbohydrate transport and metabolism].
PRK00654	glgA	0.0	185	651	4	460	glycogen synthase GlgA.
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	185	651	3	472	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK14098	PRK14098	5.28e-102	180	651	4	483	starch synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA32150.1	7.69e-173	183	651	2	472
ANU40325.1	1.54e-172	183	651	2	472
QQR06905.1	1.54e-172	183	651	2	472
BCI60006.1	1.45e-169	184	651	3	469
AGX05960.1	1.04e-167	184	652	3	472

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HLN_A	2.86e-89	182	652	125	623	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]
3D1J_A	2.59e-79	184	651	3	473	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	4.49e-79	184	651	3	473	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
6GNE_A	1.61e-78	184	651	12	494	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]
3COP_A	3.37e-78	184	651	3	473	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4IS20	5.38e-157	184	652	3	472	Glycogen synthase OS=Geobacillus thermodenitrificans (strain NG80-2) OX=420246 GN=glgA PE=3 SV=1
Q97GX6	1.16e-156	184	651	3	473	Glycogen synthase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=glgA PE=3 SV=1
O08328	2.16e-156	184	652	3	472	Glycogen synthase OS=Geobacillus stearothermophilus OX=1422 GN=glgA PE=3 SV=1
Q72YJ6	3.61e-155	183	651	2	471	Glycogen synthase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) OX=222523 GN=glgA PE=3 SV=1
Q6HC18	1.45e-154	183	651	2	471	Glycogen synthase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) OX=281309 GN=glgA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000524_00965.