CAZyme Information: MGYG000000526_00086

Basic Information

• Species: Prevotella sp900770395
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900770395
• CAZyme ID: MGYG000000526_00086
• CAZy Family: GH53
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
415		47688.08	6.9366

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000526	3510035	MAG	Fiji	Oceania

• Gene Location: Start: 110365; End: 111612 Strand: +

Full Sequence      

MNLLKSLVIAAFCTFAAESQAQKYLGGDISLLPTNEKTNSIYLDKDGKPITSLLDFFKQE
KMNAMRVRLHVNPSDFPNNDPNCCQTLDYVKALGKRIKDAGMSLMLDFHYSDTWADPAKQ
WTPKAWENLNDEQLVQKIYDYTKDVLQQMTEAGAKPDFIQTGNEISYGMLWGTANASSFK
KCYDNDNANWDRFINLLKSAGKACREVCPEAKIILHTERTADPSVQKNFYDKMKSANVDY
DIIGLSYYPIWHKTIETLNSSLNTLEKDYPDKKIMIVEVGYSYSWVPTEKEYDFSSTYPY
SEAGQEKFTKDLITMLNSHKNVNGLFWWWMEYNAYPWSTTNMDKWWYAPLFNSNTGRAMP
ALYEMKNFFDGAAGISAITKNKNAADKWFTLNGNRIETPTKQGIYINGNRKVVIK

Enzyme Prediction     

No EC number prediction in MGYG000000526_00086.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	25	362	2e-93	0.9853801169590644

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07745	Glyco_hydro_53	2.70e-89	24	362	1	330	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
COG3867	GanB	2.98e-72	26	362	42	388	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADE83762.1	6.32e-161	1	415	1	416
QVJ80245.1	4.61e-135	1	415	1	423
VEH14955.1	6.79e-126	23	368	47	397
QUT66820.1	7.33e-102	2	368	4	363
AGB28452.1	1.11e-91	1	413	1	444

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7OSK_A	7.63e-56	26	362	53	388	ChainA, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230],7OSK_B Chain B, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230]
1HJS_A	5.10e-40	21	328	1	296	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_A Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus]
4BF7_A	3.01e-38	24	328	21	313	Emericillanidulans endo-beta-1,4-galactanase [Aspergillus nidulans]
1HJQ_A	5.31e-37	21	328	1	296	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Humicola insolens]
1R8L_A	5.31e-36	26	284	27	269	Thestructure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1R8L_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1UR0_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR0_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],2CCR_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2CCR_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48843	4.02e-60	25	352	8	334	Uncharacterized protein in bgaB 5'region (Fragment) OS=Niallia circulans OX=1397 PE=3 SV=1
A1D3T4	1.54e-44	19	328	20	319	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=galA PE=3 SV=1
B0XPR3	4.47e-42	24	328	25	319	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=galA PE=3 SV=2
Q8X168	5.44e-42	19	328	15	313	Arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus niger OX=5061 GN=galA PE=1 SV=1
Q4WJ80	6.23e-42	24	328	25	319	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=galA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000357	0.998822	0.000260	0.000188	0.000181	0.000162

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000526_00086.