CAZyme Information: MGYG000000526_00243

Basic Information

• Species: Prevotella sp900770395
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900770395
• CAZyme ID: MGYG000000526_00243
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
856	MGYG000000526_1|CGC7	97837.36	7.2092

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000526	3510035	MAG	Fiji	Oceania

• Gene Location: Start: 320744; End: 323314 Strand: -

Full Sequence      

MSLKQNFLLKSTRIWRVVIMRHICITVLAAVMTPGVNAAQQFIAFKPAEGYQRIDLANAG
ILVDNKEDKAVHHAVDNLKEDIARATSPGIPKVGRKCSIVIGTTSSPLIRKYIRQGVING
NDLKGKWEKYIIAACDTDIVIAGSDRRGCVYGIYELSRQLGVSPWYWWADIPVVRHDDIY
IKKGVYTDGEPKVKYRGIFINDENPCMQKWARMKFGGMNSKMYARVYELLLRMKCNLLWP
GMWGSFKEYKPLVPILKNEDGTYEGNCFNWDDPLNPKLADEMGIVVGTSHHEPMQRSQQE
WIRTKANYGNGEWNYMTNGEALRRFFREGIENTKDYECMITVGMRGDEDRPMADAGGREA
NMRLLKRIFDDQRQIINGVMGKRAKDMLLVWTLYSEMLDYYDEGFQVPDDVTIMLCDDNW
GDIRKIPTPDTRHRKGGFGMYYHFSYYGAPRAMKWLQQMQIQHVWHQMDIAYRSGIDRVW
IVNVGDIKPAEFPTQFFMDMAWNPDRFNPDNLMEYTRDFCSQFAAGHAGEAARVLNSYCK
YAARITAEMLDENTYRTDNGEWKRVRDEFMALEAEALRIYLMLNEDCRDAYKQIILFPVQ
AMANLHDLYYSVAMNRHLASIGDMEANHWADRAEKCFERDSLLCRDYNKVMAGGKWDGMM
DEVHIGYKTWHAPQYNIMPQVVRLDSASVRHGGFINEMQCGTAYIDARRYYSAATPEGSS
WTVIPHLGKTSSALTLMPSLASTDGAALTYRIKTTQTVDSMLVKVVFSTVMPFIKGGHDV
ELGFTGCSTKTINLNKDMNWQHCYDLMYPAGAARVIEIETVLPASKTAGGCYELNLCPFV
PGIVIQGIFAQLIPPL

Enzyme Prediction     

No EC number prediction in MGYG000000526_00243.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	58	846	4.5e-244	0.9799139167862266

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	1.47e-178	189	549	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	2.61e-06	705	757	11	67	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	0.004	91	156	56	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EDV03678.1	4.74e-293	11	851	5	838
QUT90767.1	4.39e-291	21	851	9	838
ALJ58215.1	8.81e-291	21	851	9	838
ALJ48335.1	1.81e-286	17	848	7	820
EDO10801.1	2.01e-286	17	848	10	823

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C90_A	3.87e-261	30	846	22	830	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	1.15e-256	61	848	28	817	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	7.21e-255	61	848	27	816	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4ZMH_A	3.89e-160	42	681	5	631	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
6NPS_A	5.50e-108	98	671	64	646	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.060506	0.935948	0.002719	0.000299	0.000239	0.000251

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000526_00243.