CAZyme Information: MGYG000000528_00471

Basic Information

• Species: CAAFZY01 sp900767645
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-239; CAAFZY01; CAAFZY01 sp900767645
• CAZyme ID: MGYG000000528_00471
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
204		23341.99	9.6825

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000528	1493661	MAG	Fiji	Oceania

• Gene Location: Start: 17975; End: 18589 Strand: +

Full Sequence      

MLRRILFLLVISLVIVHPLKAQKEYKTDASMPIEADVSELCSLSAARMEEKYDIKDHLLQ
TISSVETGNWNYEEGRFVSWPWTINVNGKGYRFKTKEAAIAKVKQLQSEGVESIDVGCMQ
VNLKYHKKAFASLDDAFNPDKNIEYGAKFLSKLYKKQGSWQKAAMAYHSKVPARGLRYKN
KLLSRFEQIKLAAVAEEEQNISLF

Enzyme Prediction     

No EC number prediction in MGYG000000528_00471.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	57	196	2.5e-16	0.8444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16892	LT_VirB1-like	6.58e-15	59	177	14	131	VirB1-like subfamily. This subfamily includes VirB1 protein, one of twelve proteins making up type IV secretion systems (T4SS). T4SS are macromolecular assemblies generally composed of VirB1-11 and VirD4 proteins, and are used by bacteria to transport material across their membranes. VirB1 acts as a lytic transglycosylase (LT), and is important with respect to piercing the peptidoglycan layer in the periplasm. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
cd13400	LT_IagB-like	1.28e-14	52	188	1	109	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
COG0741	MltE	6.08e-08	61	196	119	268	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	2.40e-07	115	169	35	94	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	6.64e-06	116	168	25	79	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIM10590.1	3.47e-52	36	190	17	171
CAX83981.1	1.74e-42	29	195	21	187
QEX24116.1	4.04e-40	29	188	55	212
AMW35440.1	9.59e-40	38	199	42	203
CDO58992.1	6.44e-39	39	182	27	169

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000224	0.999176	0.000150	0.000149	0.000135	0.000131

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000528_00471.