CAZyme Information: MGYG000000528_01202

Basic Information

• Species: CAAFZY01 sp900767645
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-239; CAAFZY01; CAAFZY01 sp900767645
• CAZyme ID: MGYG000000528_01202
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388		43605.88	7.12

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000528	1493661	MAG	Fiji	Oceania

• Gene Location: Start: 14939; End: 16105 Strand: -

Full Sequence      

MKVYLIAGEPSGDLLGSRLMRAMINKCPNVEFYGIGGESMECEGLKSLFDISDLAVMGLA
EIIPSIPLILRRIKETVADIEAVKPDVVITIDSWSFSARVHKALKRKHLGIPQVHYVAPQ
VWAWKKKRAKTMYKYIDHLLTLFPYEPKYFTPYHLDTVFVGHPVIESSVLWGNGQDFRNR
YNIEGNCKIMTVLPGSRKTEVARLLPVFLEVVKEFSRKHQDFCFVIPTVHTVEDKVRAMV
EESGLPIKILTTESDRHDAFVASEAAIAASGTVALELAMVDVPHIIAYKVAPLTAWLAKH
FLHIQFVNLSNILLGREVVPELLQDDCNVQNIIYHVEELLKKGALYERQMEGFAKVKEIL
GLGEQTPSANACDVILSIVNKNNDKKAD

Enzyme Prediction     

No EC number prediction in MGYG000000528_01202.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	3	360	3.6e-121	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	3.98e-146	1	382	2	378	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	7.76e-144	1	381	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.35e-105	3	364	1	363	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	3.40e-81	5	367	10	372	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	4.68e-60	1	363	2	335	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIM10250.1	1.02e-169	1	381	5	386
BAE51288.1	1.38e-113	1	386	1	388
QPL37788.1	1.12e-111	2	386	10	391
AJD52204.1	1.59e-111	2	386	10	391
ARJ65449.1	2.11e-111	3	379	8	386

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	1.86e-57	1	371	7	376	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	1.86e-57	1	371	7	376	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2W4D7	2.75e-114	1	386	1	388	Lipid-A-disaccharide synthase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) OX=342108 GN=lpxB PE=3 SV=1
B6IST7	2.22e-105	3	381	6	385	Lipid-A-disaccharide synthase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) OX=414684 GN=lpxB PE=3 SV=1
Q5FUA3	9.27e-97	3	381	31	407	Lipid-A-disaccharide synthase OS=Gluconobacter oxydans (strain 621H) OX=290633 GN=lpxB PE=3 SV=1
Q0BS63	9.79e-82	3	332	6	333	Lipid-A-disaccharide synthase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) OX=391165 GN=lpxB PE=3 SV=1
Q2IW93	3.43e-79	2	381	13	392	Lipid-A-disaccharide synthase OS=Rhodopseudomonas palustris (strain HaA2) OX=316058 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000012	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000528_01202.