CAZyme Information: MGYG000000529_00477

Basic Information

• Species: UMGS1585 sp900553205
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; UMGS1585; UMGS1585 sp900553205
• CAZyme ID: MGYG000000529_00477
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372		42419.59	9.4829

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000529	1939857	MAG	Fiji	Oceania

• Gene Location: Start: 132249; End: 133367 Strand: -

Full Sequence      

MKKLFIITGDYSGDIHAGRVAEILKQKYPSLEIEGIGGENLKSAGVKLFTNQSKMGVVGL
TPKILIDHISLGKRVVDYITKDFKPDMVLLIDYGAFNLSVSKFLKRAGIKTFYYIPPQVW
ASRKWRINTIKKNIDKVLCIFPFEVEMYKSYGIETHYCGHPLVKQLPEKANRDDFFEKYG
LDKNKKLVSIFPGSREFELHNLMKVFIKAGEKLRENHSDIQFCVSHAPNLSDKVYNKYLK
HTDFKVIKGDNQALLSVSDSLILASGTVALEAALYQVPMIIAYKGPWLFYFIYLLVRCIK
MVSLPNIILGKVTVPELTQDKCTVKNIVEETEKNLYDTNIRNERISDLGEVKSKLSEKYS
AEEVAKQIVENI

Enzyme Prediction     

No EC number prediction in MGYG000000529_00477.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	5	355	5e-103	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	5.31e-110	1	370	1	373	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	5.43e-104	1	370	1	377	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	2.29e-77	4	370	1	372	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	4.72e-70	6	371	10	372	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.15e-46	1	372	1	347	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39331.1	8.91e-192	1	370	1	370
CAZ95243.1	9.95e-70	3	372	2	370
QKJ96197.1	3.80e-69	3	370	7	376
QMU61387.1	6.15e-69	4	358	13	370
ADV48241.1	9.79e-69	3	372	2	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	1.04e-42	6	322	11	332	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	2.82e-42	6	322	11	332	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A9NCA7	6.33e-67	2	372	4	373	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) OX=360115 GN=lpxB PE=3 SV=1
B6J161	6.33e-67	2	368	4	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1
A9KC41	6.33e-67	2	372	4	373	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain Dugway 5J108-111) OX=434922 GN=lpxB PE=3 SV=1
Q83DS5	6.33e-67	2	372	4	373	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) OX=227377 GN=lpxB PE=3 SV=1
B6J9H1	8.93e-67	2	372	4	373	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuK_Q154) OX=434924 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000529_00477.