CAZyme Information: MGYG000000529_01806

Basic Information

• Species: UMGS1585 sp900553205
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; UMGS1585; UMGS1585 sp900553205
• CAZyme ID: MGYG000000529_01806
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
228		24568.84	10.6789

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000529	1939857	MAG	Fiji	Oceania

• Gene Location: Start: 25095; End: 25781 Strand: -

Full Sequence      

MIRKLVLFTTMIVMLLSTKVNASEVPVNHVKNTIVRHSVALGVDPAIALSIAKVESGYNH
SRRSAYGAVGVFQLMPSTAAKLGVNPYHLSDNIRGGILYYKMMYKMFGSTELALAAYNAG
PAYIIKHHCAPPSTRGYVAKTMAEYHKIKATPGAVTVAKKPVVTQPQHHKITPAPVAISS
HGSVKPMTASVPRVINDGTNKLIIKQAPTTTRAPKLQVSINKATDPYS

Enzyme Prediction     

No EC number prediction in MGYG000000529_01806.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	45	150	1e-22	0.8148148148148148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	4.11e-29	45	145	1	110	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16896	LT_Slt70-like	9.28e-26	31	145	5	144	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	2.33e-24	31	121	7	108	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd13403	MLTF-like	5.29e-21	34	126	1	101	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16894	MltD-like	1.64e-19	51	143	13	126	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39353.1	5.63e-47	3	220	2	216
AQS48216.1	7.73e-25	27	138	92	201
ATE60499.1	1.14e-24	42	152	81	195
AXA43511.1	7.72e-24	42	166	106	234
ASS60443.1	9.46e-24	42	153	117	232

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	9.32e-09	31	143	417	550	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	9.34e-09	31	143	421	554	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	9.37e-09	31	143	427	560	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	9.39e-09	31	143	431	564	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	9.42e-09	31	143	437	570	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31976	7.35e-20	43	147	1435	1543	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	7.35e-20	43	147	1435	1543	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31608	2.53e-18	42	146	72	180	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P27380	5.27e-08	33	120	10	98	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000220	0.999133	0.000170	0.000165	0.000156	0.000143

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000529_01806.