CAZyme Information: MGYG000000530_00257

Basic Information

• Species: PeH17 sp000435055
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-138; PeH17; PeH17 sp000435055
• CAZyme ID: MGYG000000530_00257
• CAZy Family: GT2
• CAZyme Description: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357	MGYG000000530_4|CGC1	40087.55	9.6364

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000530	1956406	MAG	Fiji	Oceania

• Gene Location: Start: 36706; End: 37779 Strand: +

Full Sequence      

MIVVIPAYEPDEKLLRLVDELKQQTDYKIIIVDDGSKNAESKDVFSKLEEDSAVTVLHHK
VNRGKGRAMKTAFEYIRDAGFSDDGIITVDADGQHLIKDIVAVSETWAKNPNALVLGSRR
FSGKVPLRSRFGNGVTRGVFAISTGVRVYDTQTGLRAFSTEKLDDMLKIGGERYEYEINQ
LLTCTKTHVPIIEHTIETVYLNKNETSHFNTVKDSWRIYKTIFTFVFSSFVSWAADYILL
LVFNAILGGITGGAAVRLLSFNLPPKFFALVGARTISSLLNYFLNQRLVFQTKSKGSVLR
YYILVAALFVLNYGLLQLMGKIGIALWLAQIIAQLVIYPLSFVIQRKFVFCEKNTAA

Enzyme Prediction     

No EC number prediction in MGYG000000530_00257.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	3	131	2.7e-21	0.7411764705882353

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04179	DPM_DPG-synthase_like	3.21e-38	3	178	1	179	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.
COG0463	WcaA	1.60e-15	3	250	7	241	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd04188	DPG_synthase	2.09e-15	3	193	1	199	DPG_synthase is involved in protein N-linked glycosylation. UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate.
pfam00535	Glycos_transf_2	2.52e-15	3	159	2	155	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
PTZ00260	PTZ00260	1.77e-14	3	223	74	310	dolichyl-phosphate beta-glucosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCO04770.1	7.12e-87	4	354	9	343
QIP50070.1	5.88e-86	4	357	7	348
AGY38775.1	2.43e-85	4	354	5	343
AGY40254.1	2.43e-85	4	354	5	343
AMD97041.1	8.84e-85	3	355	4	344

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58619	1.27e-16	3	227	21	243	Uncharacterized protein MJ1222 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1222 PE=4 SV=1
B3VA58	1.30e-15	4	200	9	220	UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminyltransferase OS=Methanococcus voltae OX=2188 GN=aglK PE=1 SV=1
Q54J42	3.62e-11	3	211	78	303	Dolichyl-phosphate beta-glucosyltransferase OS=Dictyostelium discoideum OX=44689 GN=alg5 PE=2 SV=1
A2EK20	2.29e-09	4	161	78	249	Dolichyl-phosphate beta-glucosyltransferase ALG5B OS=Trichomonas vaginalis OX=5722 GN=ALG5B PE=1 SV=1
A2DZE8	3.90e-09	4	161	78	246	Dolichyl-phosphate beta-glucosyltransferase ALG5A OS=Trichomonas vaginalis OX=5722 GN=ALG5A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
225	247
267	284
296	318
322	344