CAZyme Information: MGYG000000530_00476

Basic Information

• Species: PeH17 sp000435055
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-138; PeH17; PeH17 sp000435055
• CAZyme ID: MGYG000000530_00476
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
212		24362.62	7.1654

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000530	1956406	MAG	Fiji	Oceania

• Gene Location: Start: 31091; End: 31729 Strand: +

Full Sequence      

MAKKAAKRKNTRKNTGSRKNGGRNRLWIIFAGCCIALALAVAAVFQKPVRRHFSYPMEYE
AEVRRACEKYDLDPCLVFAVIRTESFFTPDAVSGAGAQGLMQIMPETGEWIAWRQGKEYD
ESRIFEPDYNIDLGCWLLSFLLEKYNGDVELAAAAYNAGHSAVNRWLDDPKYYDGKNLTI
PYEETENYVKKVKDAYEKYQFLRESEHEAGRE

Enzyme Prediction     

No EC number prediction in MGYG000000530_00476.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	73	201	1.1e-32	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	4.70e-73	56	198	1	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.03e-60	55	202	2	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	1.72e-43	74	197	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	4.59e-39	51	203	131	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	1.24e-36	63	178	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYH39946.1	2.40e-53	16	204	5	195
QWT54455.1	1.56e-46	10	200	5	203
VTQ87399.1	2.86e-45	29	199	5	179
ADD02091.1	9.59e-45	36	205	7	183
ADV80073.1	1.98e-44	55	205	31	184

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FBT_A	4.40e-22	55	192	445	585	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	4.50e-22	55	192	474	614	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FC4_A	1.11e-21	55	192	446	586	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FCQ_A	1.11e-21	55	192	445	585	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
5MPQ_A	1.07e-19	51	192	404	548	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	1.24e-23	60	196	61	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O64046	1.88e-20	54	198	1417	1543	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	1.88e-20	54	198	1417	1543	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
B0BSH0	2.72e-15	58	203	196	365	Membrane-bound lytic murein transglycosylase C OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) OX=434271 GN=mltC PE=3 SV=1
B3GYW8	2.72e-15	58	203	196	365	Membrane-bound lytic murein transglycosylase C OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) OX=537457 GN=mltC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999924	0.000082	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
26	45